Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 405184..405852 | Replicon | chromosome |
Accession | NZ_CP113267 | ||
Organism | Streptococcus pneumoniae strain BC2 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | B1I7Q0 |
Locus tag | OTB22_RS02130 | Protein ID | WP_001132285.1 |
Coordinates | 405184..405363 (+) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | G0IC64 |
Locus tag | OTB22_RS02135 | Protein ID | WP_000961810.1 |
Coordinates | 405400..405852 (+) | Length | 151 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OTB22_RS02105 (OTB22_02110) | 401053..402372 | + | 1320 | WP_061761994.1 | glycoside hydrolase family 32 protein | - |
OTB22_RS02115 (OTB22_02120) | 402923..404194 | - | 1272 | WP_001113212.1 | replication-associated recombination protein A | - |
OTB22_RS02120 (OTB22_02125) | 404464..404703 | + | 240 | WP_000818078.1 | hypothetical protein | - |
OTB22_RS02125 (OTB22_02130) | 404868..405047 | + | 180 | WP_001048906.1 | hypothetical protein | - |
OTB22_RS02130 (OTB22_02135) | 405184..405363 | + | 180 | WP_001132285.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
OTB22_RS02135 (OTB22_02140) | 405400..405852 | + | 453 | WP_000961810.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OTB22_RS02140 (OTB22_02145) | 406143..406613 | + | 471 | WP_023396411.1 | DUF3013 family protein | - |
OTB22_RS02145 (OTB22_02150) | 406669..407211 | + | 543 | WP_000891117.1 | hypothetical protein | - |
OTB22_RS02150 (OTB22_02155) | 407261..407695 | + | 435 | WP_000421871.1 | NUDIX hydrolase | - |
OTB22_RS02155 (OTB22_02160) | 407692..408165 | + | 474 | WP_023396410.1 | GNAT family N-acetyltransferase | - |
OTB22_RS02160 (OTB22_02165) | 408303..409253 | + | 951 | WP_023396409.1 | 50S ribosomal protein L11 methyltransferase | - |
OTB22_RS02165 (OTB22_02170) | 409255..409998 | + | 744 | WP_023396408.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6713.01 Da Isoelectric Point: 11.2964
>T265675 WP_001132285.1 NZ_CP113267:405184-405363 [Streptococcus pneumoniae]
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERPITILHGKLNKYTERGIRKQAGL
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERPITILHGKLNKYTERGIRKQAGL
Download Length: 180 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16659.46 Da Isoelectric Point: 3.7220
>AT265675 WP_000961810.1 NZ_CP113267:405400-405852 [Streptococcus pneumoniae]
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0T9HEZ5 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5YRZ | |
AlphaFold DB | G0IC64 |