Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 793648..794316 | Replicon | chromosome |
| Accession | NZ_CP113266 | ||
| Organism | Streptococcus pneumoniae strain BC1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | C1C927 |
| Locus tag | OS912_RS03890 | Protein ID | WP_001132282.1 |
| Coordinates | 794137..794316 (-) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | G0IC64 |
| Locus tag | OS912_RS03885 | Protein ID | WP_000961810.1 |
| Coordinates | 793648..794100 (-) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS912_RS03860 (OS912_03865) | 789538..790281 | - | 744 | WP_001188182.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| OS912_RS03865 (OS912_03870) | 790283..791233 | - | 951 | WP_268233018.1 | 50S ribosomal protein L11 methyltransferase | - |
| OS912_RS03870 (OS912_03875) | 791371..791799 | - | 429 | WP_000418168.1 | NUDIX hydrolase | - |
| OS912_RS03875 (OS912_03880) | 791780..792868 | - | 1089 | WP_000719700.1 | site-2 protease family protein | - |
| OS912_RS03880 (OS912_03885) | 792887..793357 | - | 471 | WP_000257084.1 | DUF3013 family protein | - |
| OS912_RS03885 (OS912_03890) | 793648..794100 | - | 453 | WP_000961810.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| OS912_RS03890 (OS912_03895) | 794137..794316 | - | 180 | WP_001132282.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| OS912_RS03895 (OS912_03900) | 794453..794632 | - | 180 | WP_001048906.1 | hypothetical protein | - |
| OS912_RS03900 (OS912_03905) | 794836..795036 | - | 201 | WP_000818077.1 | hypothetical protein | - |
| OS912_RS03905 (OS912_03910) | 795306..796577 | + | 1272 | WP_001113212.1 | replication-associated recombination protein A | - |
| OS912_RS03915 (OS912_03920) | 797123..798442 | - | 1320 | WP_050102825.1 | glycoside hydrolase family 32 protein | - |
| OS912_RS03920 (OS912_03925) | 798452..799297 | - | 846 | WP_000819519.1 | carbohydrate ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6713.95 Da Isoelectric Point: 11.0174
>T265674 WP_001132282.1 NZ_CP113266:c794316-794137 [Streptococcus pneumoniae]
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERLITIPHGELNKYTERGIRKQAGL
MPMTQKEMVKLLTAHGWIKTRGGKGSHIKMEKQGERLITIPHGELNKYTERGIRKQAGL
Download Length: 180 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16659.46 Da Isoelectric Point: 3.7220
>AT265674 WP_000961810.1 NZ_CP113266:c794100-793648 [Streptococcus pneumoniae]
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
MLVTYPALFYYDDTDGTEATYFVHFPDFEYSATQGEGISEALAMGSEWLGITVADLIESDGELPQPSDINSLSLIDNDPF
KDDEDFVSTYDLDKSFISMVSVDVSEYLGSQEPIKKTLTIPKWADKLGREMGLNFSQTLTDAIADKKVQA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E7SUI3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 5YRZ | |
| AlphaFold DB | G0IC64 |