Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 288709..289340 | Replicon | chromosome |
Accession | NZ_CP113264 | ||
Organism | Streptomonospora nanhaiensis strain 12A09 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OUQ99_RS01360 | Protein ID | WP_267947586.1 |
Coordinates | 288709..289122 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | OUQ99_RS01365 | Protein ID | WP_267947587.1 |
Coordinates | 289119..289340 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OUQ99_RS01340 (OUQ99_01340) | 284408..285115 | - | 708 | WP_267950211.1 | WbqC family protein | - |
OUQ99_RS01345 (OUQ99_01345) | 285510..287048 | + | 1539 | WP_267947583.1 | glycosyltransferase | - |
OUQ99_RS01350 (OUQ99_01350) | 287177..287587 | + | 411 | WP_267947584.1 | DUF3817 domain-containing protein | - |
OUQ99_RS01355 (OUQ99_01355) | 287563..288351 | - | 789 | WP_267947585.1 | SURF1 family protein | - |
OUQ99_RS01360 (OUQ99_01360) | 288709..289122 | - | 414 | WP_267947586.1 | PIN domain-containing protein | Toxin |
OUQ99_RS01365 (OUQ99_01365) | 289119..289340 | - | 222 | WP_267947587.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OUQ99_RS01370 (OUQ99_01370) | 289440..289973 | - | 534 | WP_267947588.1 | DinB family protein | - |
OUQ99_RS01375 (OUQ99_01375) | 290129..290896 | + | 768 | WP_267947589.1 | alpha/beta fold hydrolase | - |
OUQ99_RS01380 (OUQ99_01380) | 290998..291405 | - | 408 | WP_267947590.1 | VOC family protein | - |
OUQ99_RS01385 (OUQ99_01385) | 291629..292291 | - | 663 | WP_267947591.1 | class II aldolase/adducin family protein | - |
OUQ99_RS01390 (OUQ99_01390) | 292613..294139 | + | 1527 | WP_267947592.1 | aldehyde dehydrogenase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15669.57 Da Isoelectric Point: 6.9177
>T265669 WP_267947586.1 NZ_CP113264:c289122-288709 [Streptomonospora nanhaiensis]
VIRYLIDSSALWRVLRDPKHRDAWRDVVVEGAVGSCAVQRTEFRRSARNLDEYEQFNEMFETLHPDVPTPKSAWQWVESA
QYRLLRGGAHRAMSSVDLLIAATAAHHGLVVLHDDNDFATAAHHLTDLRERSVRNTP
VIRYLIDSSALWRVLRDPKHRDAWRDVVVEGAVGSCAVQRTEFRRSARNLDEYEQFNEMFETLHPDVPTPKSAWQWVESA
QYRLLRGGAHRAMSSVDLLIAATAAHHGLVVLHDDNDFATAAHHLTDLRERSVRNTP
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|