Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 2503735..2504428 | Replicon | chromosome |
Accession | NZ_CP113257 | ||
Organism | Stutzerimonas frequens strain TF18 |
Toxin (Protein)
Gene name | tad | Uniprot ID | N2IHR9 |
Locus tag | OSV15_RS12200 | Protein ID | WP_003151133.1 |
Coordinates | 2503735..2504112 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | N2IIN5 |
Locus tag | OSV15_RS12205 | Protein ID | WP_001172026.1 |
Coordinates | 2504093..2504428 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSV15_RS12190 (OSV15_12190) | 2499928..2502957 | - | 3030 | WP_010799689.1 | Tn3 family transposase | - |
OSV15_RS12195 (OSV15_12195) | 2502941..2503543 | - | 603 | WP_010465829.1 | recombinase family protein | - |
OSV15_RS12200 (OSV15_12200) | 2503735..2504112 | + | 378 | WP_003151133.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OSV15_RS12205 (OSV15_12205) | 2504093..2504428 | + | 336 | WP_001172026.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OSV15_RS12210 (OSV15_12210) | 2504443..2504778 | + | 336 | WP_000741275.1 | hypothetical protein | - |
OSV15_RS12215 (OSV15_12215) | 2504802..2505128 | + | 327 | WP_000091614.1 | hypothetical protein | - |
OSV15_RS12220 (OSV15_12220) | 2505144..2505485 | + | 342 | WP_025999701.1 | hypothetical protein | - |
OSV15_RS12225 (OSV15_12225) | 2505786..2506880 | - | 1095 | WP_125882712.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13705.78 Da Isoelectric Point: 9.4693
>T265667 WP_003151133.1 NZ_CP113257:2503735-2504112 [Stutzerimonas frequens]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024ELN5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024EKI7 |