Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1319281..1320197 | Replicon | chromosome |
Accession | NZ_CP113256 | ||
Organism | Bacillus subtilis strain K1 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | ORP33_RS06930 | Protein ID | WP_003244695.1 |
Coordinates | 1319451..1320197 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | ORP33_RS06925 | Protein ID | WP_003232646.1 |
Coordinates | 1319281..1319451 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORP33_RS06890 (1316141) | 1316141..1316470 | + | 330 | WP_080529228.1 | XkdW family protein | - |
ORP33_RS06895 (1316467) | 1316467..1316631 | + | 165 | WP_047182493.1 | XkdX family protein | - |
ORP33_RS06900 (1316678) | 1316678..1317517 | + | 840 | WP_029317677.1 | phage-like element PBSX protein XepA | - |
ORP33_RS06905 (1317570) | 1317570..1317839 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
ORP33_RS06910 (1317852) | 1317852..1318115 | + | 264 | WP_029317678.1 | phage holin | - |
ORP33_RS06915 (1318128) | 1318128..1319021 | + | 894 | WP_029317679.1 | N-acetylmuramoyl-L-alanine amidase | - |
ORP33_RS06920 (1319058) | 1319058..1319195 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
ORP33_RS06925 (1319281) | 1319281..1319451 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
ORP33_RS06930 (1319451) | 1319451..1320197 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
ORP33_RS06935 (1320307) | 1320307..1321308 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
ORP33_RS06940 (1321321) | 1321321..1321938 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
ORP33_RS06945 (1322214) | 1322214..1323530 | - | 1317 | WP_080529229.1 | serine/threonine exchanger | - |
ORP33_RS06950 (1323914) | 1323914..1324864 | + | 951 | WP_225721960.1 | ring-cleaving dioxygenase | - |
ORP33_RS06955 (1324973) | 1324973..1325068 | + | 96 | Protein_1306 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1285238..1340628 | 55390 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T265661 WP_003244695.1 NZ_CP113256:c1320197-1319451 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|