Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 513288..513924 | Replicon | chromosome |
Accession | NZ_CP113256 | ||
Organism | Bacillus subtilis strain K1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | ORP33_RS02625 | Protein ID | WP_003156187.1 |
Coordinates | 513574..513924 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | ORP33_RS02620 | Protein ID | WP_003225183.1 |
Coordinates | 513288..513569 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORP33_RS02600 (509648) | 509648..510247 | - | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
ORP33_RS02605 (510342) | 510342..510707 | + | 366 | WP_015252768.1 | holo-ACP synthase | - |
ORP33_RS02610 (510873) | 510873..511889 | + | 1017 | WP_072557167.1 | outer membrane lipoprotein carrier protein LolA | - |
ORP33_RS02615 (512003) | 512003..513172 | + | 1170 | WP_015252766.1 | alanine racemase | - |
ORP33_RS02620 (513288) | 513288..513569 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
ORP33_RS02625 (513574) | 513574..513924 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
ORP33_RS02630 (514039) | 514039..514863 | + | 825 | WP_015252765.1 | RsbT co-antagonist protein RsbRA | - |
ORP33_RS02635 (514868) | 514868..515233 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
ORP33_RS02640 (515237) | 515237..515638 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
ORP33_RS02645 (515650) | 515650..516657 | + | 1008 | WP_015252763.1 | phosphoserine phosphatase RsbU | - |
ORP33_RS02650 (516719) | 516719..517048 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
ORP33_RS02655 (517045) | 517045..517527 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
ORP33_RS02660 (517493) | 517493..518281 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
ORP33_RS02665 (518281) | 518281..518880 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T265660 WP_003156187.1 NZ_CP113256:513574-513924 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|