Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09907-MazE |
| Location | 5323..5924 | Replicon | plasmid plas1 |
| Accession | NZ_CP113251 | ||
| Organism | Levilactobacillus brevis strain SC013 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | Q684P1 |
| Locus tag | OUY26_RS12235 | Protein ID | WP_001748110.1 |
| Coordinates | 5323..5667 (-) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A806J926 |
| Locus tag | OUY26_RS12240 | Protein ID | WP_001748109.1 |
| Coordinates | 5661..5924 (-) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OUY26_RS12210 (OUY26_12210) | 373..1527 | + | 1155 | WP_267925647.1 | cation:proton antiporter | - |
| OUY26_RS12215 (OUY26_12215) | 1659..2434 | + | 776 | WP_267925648.1 | IS5-like element ISLpl3 family transposase | - |
| OUY26_RS12220 (OUY26_12220) | 2505..4073 | + | 1569 | WP_267925650.1 | ClC family H(+)/Cl(-) exchange transporter | - |
| OUY26_RS12225 (OUY26_12225) | 4179..4268 | + | 90 | Protein_3 | IS30 family transposase | - |
| OUY26_RS12230 (OUY26_12230) | 4310..4777 | - | 468 | WP_003587210.1 | DNA starvation/stationary phase protection protein | - |
| OUY26_RS12235 (OUY26_12235) | 5323..5667 | - | 345 | WP_001748110.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OUY26_RS12240 (OUY26_12240) | 5661..5924 | - | 264 | WP_001748109.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| OUY26_RS12245 (OUY26_12245) | 6010..6597 | + | 588 | WP_267925651.1 | site-specific integrase | - |
| OUY26_RS12250 (OUY26_12250) | 6826..7053 | + | 228 | WP_267925654.1 | hypothetical protein | - |
| OUY26_RS12255 (OUY26_12255) | 7076..7354 | + | 279 | WP_015474680.1 | hypothetical protein | - |
| OUY26_RS12260 (OUY26_12260) | 7344..7850 | - | 507 | Protein_10 | hypothetical protein | - |
| OUY26_RS12265 (OUY26_12265) | 7840..8121 | - | 282 | WP_014564139.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| OUY26_RS12270 (OUY26_12270) | 8400..8531 | - | 132 | WP_267925652.1 | hypothetical protein | - |
| OUY26_RS12275 (OUY26_12275) | 9020..9412 | - | 393 | WP_082265502.1 | hypothetical protein | - |
| OUY26_RS12280 (OUY26_12280) | 9607..9804 | - | 198 | WP_267925653.1 | hypothetical protein | - |
| OUY26_RS12285 (OUY26_12285) | 9984..10262 | - | 279 | WP_015474677.1 | BRCT domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..21989 | 21989 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13041.89 Da Isoelectric Point: 6.4782
>T265659 WP_001748110.1 NZ_CP113251:c5667-5323 [Levilactobacillus brevis]
MVSQGDIFYVNFNPSRGHEQMNKRPAIALSNDLVCQTSNMTIVAPISSTKRNFPMYHRLTSSQTVYGKVLLDQTIALDLR
ARHVTDETIVDHVSREELEEIITLYKLLFSIDDK
MVSQGDIFYVNFNPSRGHEQMNKRPAIALSNDLVCQTSNMTIVAPISSTKRNFPMYHRLTSSQTVYGKVLLDQTIALDLR
ARHVTDETIVDHVSREELEEIITLYKLLFSIDDK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0R2K1X3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A806J926 |