Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 6109657..6110162 | Replicon | chromosome |
| Accession | NZ_CP113246 | ||
| Organism | Pseudomonas aeruginosa strain SMC4386 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | OUY23_RS28255 | Protein ID | WP_003083773.1 |
| Coordinates | 6109881..6110162 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | OUY23_RS28250 | Protein ID | WP_003083775.1 |
| Coordinates | 6109657..6109884 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OUY23_RS28225 (OUY23_28225) | 6104675..6106168 | + | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
| OUY23_RS28230 (OUY23_28230) | 6106337..6107764 | + | 1428 | WP_003083784.1 | GABA permease | - |
| OUY23_RS28235 (OUY23_28235) | 6107846..6108187 | - | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| OUY23_RS28240 (OUY23_28240) | 6108260..6108760 | - | 501 | WP_003112629.1 | LEA type 2 family protein | - |
| OUY23_RS28245 (OUY23_28245) | 6108861..6109481 | + | 621 | WP_003101226.1 | hypothetical protein | - |
| OUY23_RS28250 (OUY23_28250) | 6109657..6109884 | + | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| OUY23_RS28255 (OUY23_28255) | 6109881..6110162 | + | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| OUY23_RS28260 (OUY23_28260) | 6110462..6111370 | + | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
| OUY23_RS28265 (OUY23_28265) | 6111402..6111812 | - | 411 | WP_003101225.1 | aegerolysin family protein | - |
| OUY23_RS28270 (OUY23_28270) | 6111992..6112726 | - | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
| OUY23_RS28275 (OUY23_28275) | 6112827..6113513 | - | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| OUY23_RS28280 (OUY23_28280) | 6113562..6114911 | - | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T265658 WP_003083773.1 NZ_CP113246:6109881-6110162 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|