Detailed information of TA system TA265653

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): /BrnT(toxin)
• Location: 247848..248346
• Replicon: chromosome
• Accession: NZ_CP113242
• Organism: Vibrio sp. gvc

Toxin (Protein)

• Gene name: -
• Uniprot ID: -
• Locus tag: OOK74_RS12885
• Protein ID: WP_277208558.1
• Coordinates: 248080..248346 (-)
• Length: 89 a.a.

Antitoxin (Protein)

• Gene name: -
• Uniprot ID: -
• Locus tag: OOK74_RS12880
• Protein ID: WP_274722969.1
• Coordinates: 247848..248093 (-)
• Length: 82 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OOK74_RS12830	243198..243260	-	63	WP_234405299.1	hypothetical protein	-
OOK74_RS12835	243499..243651	-	153	WP_278183599.1	DUF645 family protein	-
OOK74_RS12840	244028..244150	-	123	WP_278183531.1	DUF645 family protein	-
OOK74_RS12845	244391..244522	-	132	WP_278183490.1	DUF3265 domain-containing protein	-
OOK74_RS12850	244555..244707	-	153	WP_278183491.1	DUF645 family protein	-
OOK74_RS12855	245003..245530	-	528	WP_278183532.1	hypothetical protein	-
OOK74_RS12860	246109..246354	+	246	WP_278183534.1	type II toxin-antitoxin system CcdA family antitoxin	-
OOK74_RS12865	246354..246671	+	318	WP_278183536.1	CcdB family protein	-
OOK74_RS12870	246844..247032	-	189	WP_278183538.1	DUF645 family protein	-
OOK74_RS12875	247371..247523	-	153	WP_278183600.1	DUF645 family protein	-
OOK74_RS12880	247848..248093	-	246	WP_274722969.1	CopG family transcriptional regulator	Antitoxin
OOK74_RS12885	248080..248346	-	267	WP_277208558.1	BrnT family toxin	Toxin
OOK74_RS12890	248413..248544	-	132	WP_278183490.1	DUF3265 domain-containing protein	-
OOK74_RS12895	248578..248730	-	153	WP_278183491.1	DUF645 family protein	-
OOK74_RS12900	248940..249059	-	120	WP_278183578.1	DUF3265 domain-containing protein	-
OOK74_RS12905	249131..249583	+	453	WP_278183484.1	DUF2384 domain-containing protein	-
OOK74_RS12910	249583..250053	+	471	WP_278183485.1	RES family NAD+ phosphorylase	-
OOK74_RS12915	250105..250200	-	96	WP_274723413.1	DUF3265 domain-containing protein	-
OOK74_RS12920	250243..250380	-	138	WP_278183579.1	DUF645 family protein	-
OOK74_RS12925	250483..250649	-	167	Protein_296	acetyltransferase	-
OOK74_RS12930	250716..251144	-	429	WP_254912775.1	GIY-YIG nuclease family protein	-
OOK74_RS12935	251304..251999	-	696	WP_278183539.1	aspartate/glutamate racemase family protein	-
OOK74_RS12940	252059..252910	-	852	WP_274722971.1	IS3 family transposase	-
OOK74_RS12945	252907..253215	-	309	WP_274722970.1	transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Integron	qnrVC4	-	188538..263116	74578
	-	inside	Integron	-	-	188538..263116	74578

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Ribonuclease toxin, BrnT, of type II toxin-antitoxin system (6-81)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 89 a.a.
• Molecular weight: 10164.47 Da
• Isoelectric Point: 6.7253

>T265653 WP_277208558.1 NZ_CP113242:c248346-248080 [Vibrio sp. gvc]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGMNIRLISVRRSRKA
EIDLYESA

Nucleotide

• Length: 267 bp

Antitoxin

Protein

• Length: 82 a.a.
• Molecular weight: 9517.85 Da
• Isoelectric Point: 6.4832

>AT265653 WP_274722969.1 NZ_CP113242:c248093-247848 [Vibrio sp. gvc]
MKAHEFDAKFESDDDDILMDLDLSQVKRPMHKQKRVNVDFPAWMLESLDREANRVGVTRQSIIKIWLAERLESVSHHASV
R

Nucleotide

• Length: 246 bp