Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /GNAT-DUF1778 |
| Location | 223718..224484 | Replicon | chromosome |
| Accession | NZ_CP113242 | ||
| Organism | Vibrio sp. gvc | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | OOK74_RS12635 | Protein ID | WP_278183482.1 |
| Coordinates | 223987..224484 (+) | Length | 166 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | OOK74_RS12630 | Protein ID | WP_274723737.1 |
| Coordinates | 223718..223990 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OOK74_RS12595 | 219809..220717 | - | 909 | WP_278183512.1 | hypothetical protein | - |
| OOK74_RS12600 | 220919..221500 | - | 582 | WP_278183513.1 | hypothetical protein | - |
| OOK74_RS12605 | 221531..221647 | - | 117 | WP_277206986.1 | DUF3265 domain-containing protein | - |
| OOK74_RS12610 | 221711..221953 | + | 243 | WP_277206988.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| OOK74_RS12615 | 221950..222249 | + | 300 | WP_278183514.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| OOK74_RS12620 | 222257..222349 | - | 93 | WP_079857208.1 | DUF3265 domain-containing protein | - |
| OOK74_RS12625 | 222364..222888 | - | 525 | WP_278183515.1 | DUF4476 domain-containing protein | - |
| OOK74_RS12630 | 223718..223990 | + | 273 | WP_274723737.1 | DUF1778 domain-containing protein | Antitoxin |
| OOK74_RS12635 | 223987..224484 | + | 498 | WP_278183482.1 | GNAT family N-acetyltransferase | Toxin |
| OOK74_RS12640 | 224578..225186 | - | 609 | WP_278183516.1 | hypothetical protein | - |
| OOK74_RS12645 | 225217..225309 | - | 93 | WP_278183517.1 | DUF3265 domain-containing protein | - |
| OOK74_RS12650 | 225359..225913 | - | 555 | WP_278183518.1 | hypothetical protein | - |
| OOK74_RS12655 | 226123..226311 | - | 189 | WP_278183519.1 | DUF645 family protein | - |
| OOK74_RS12660 | 226486..226596 | - | 111 | WP_278183590.1 | DUF3265 domain-containing protein | - |
| OOK74_RS12665 | 226593..227504 | - | 912 | WP_278183520.1 | HNH endonuclease | - |
| OOK74_RS12670 | 227539..227631 | - | 93 | WP_079720574.1 | DUF3265 domain-containing protein | - |
| OOK74_RS12675 | 227654..228094 | - | 441 | WP_278183521.1 | DUF2513 domain-containing protein | - |
| OOK74_RS12680 | 228239..228655 | - | 417 | WP_278183522.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integron | qnrVC4 | - | 188538..263116 | 74578 | |
| - | inside | Integron | - | - | 188538..263116 | 74578 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 18639.35 Da Isoelectric Point: 8.8085
>T265652 WP_278183482.1 NZ_CP113242:223987-224484 [Vibrio sp. gvc]
MMNTVLLDKDKHDRNRFNCGIEALNNYLKVMSSQQAKKDNTRTFVLEDDNNNTHIIGFYTLTMTPIDLKALPDKLQKKHQ
LSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RANLG
MMNTVLLDKDKHDRNRFNCGIEALNNYLKVMSSQQAKKDNTRTFVLEDDNNNTHIIGFYTLTMTPIDLKALPDKLQKKHQ
LSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RANLG
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|