Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 221711..222249 Replicon chromosome
Accession NZ_CP113242
Organism Vibrio sp. gvc

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag OOK74_RS12615 Protein ID WP_278183514.1
Coordinates 221950..222249 (+) Length 100 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag OOK74_RS12610 Protein ID WP_277206988.1
Coordinates 221711..221953 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OOK74_RS12570 216885..217013 - 129 WP_278183581.1 DUF3265 domain-containing protein -
OOK74_RS12575 217386..217742 - 357 WP_274723709.1 DUF6404 family protein -
OOK74_RS12580 217946..218098 - 153 WP_278183589.1 DUF645 family protein -
OOK74_RS12585 218067..218360 - 294 WP_278183622.1 hypothetical protein -
OOK74_RS12590 218417..219649 - 1233 WP_221887097.1 hypothetical protein -
OOK74_RS12595 219809..220717 - 909 WP_278183512.1 hypothetical protein -
OOK74_RS12600 220919..221500 - 582 WP_278183513.1 hypothetical protein -
OOK74_RS12605 221531..221647 - 117 WP_277206986.1 DUF3265 domain-containing protein -
OOK74_RS12610 221711..221953 + 243 WP_277206988.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
OOK74_RS12615 221950..222249 + 300 WP_278183514.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OOK74_RS12620 222257..222349 - 93 WP_079857208.1 DUF3265 domain-containing protein -
OOK74_RS12625 222364..222888 - 525 WP_278183515.1 DUF4476 domain-containing protein -
OOK74_RS12630 223718..223990 + 273 WP_274723737.1 DUF1778 domain-containing protein -
OOK74_RS12635 223987..224484 + 498 WP_278183482.1 GNAT family N-acetyltransferase -
OOK74_RS12640 224578..225186 - 609 WP_278183516.1 hypothetical protein -
OOK74_RS12645 225217..225309 - 93 WP_278183517.1 DUF3265 domain-containing protein -
OOK74_RS12650 225359..225913 - 555 WP_278183518.1 hypothetical protein -
OOK74_RS12655 226123..226311 - 189 WP_278183519.1 DUF645 family protein -
OOK74_RS12660 226486..226596 - 111 WP_278183590.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integron qnrVC4 - 188538..263116 74578
- inside Integron - - 188538..263116 74578


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-92)

Antitoxin

Antitoxin ParD

(1-79)


Sequences

Toxin        


Download         Length: 100 a.a.        Molecular weight: 11603.31 Da        Isoelectric Point: 9.9232

>T265651 WP_278183514.1 NZ_CP113242:221950-222249 [Vibrio sp. gvc]
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNIYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA

Download         Length: 300 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9003.93 Da        Isoelectric Point: 4.2813

>AT265651 WP_277206988.1 NZ_CP113242:221711-221953 [Vibrio sp. gvc]
MAKNTSITLGDHFDGFIASQIQRGRYGSASEVIRSALRLLENQETKLQSLRQLLVEGEQSGDVDYDLDSFINELDSENIR

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References