Detailed information of TA system TA265650

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): relBE/Phd(antitoxin)
• Location: 213754..214301
• Replicon: chromosome
• Accession: NZ_CP113242
• Organism: Vibrio sp. gvc

Toxin (Protein)

• Gene name: relE
• Uniprot ID: -
• Locus tag: OOK74_RS12535
• Protein ID: WP_278183508.1
• Coordinates: 213754..214056 (-)
• Length: 101 a.a.

Antitoxin (Protein)

• Gene name: relB
• Uniprot ID: -
• Locus tag: OOK74_RS12540
• Protein ID: WP_278183509.1
• Coordinates: 214044..214301 (-)
• Length: 86 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OOK74_RS12465	208946..209068	-	123	WP_278183502.1	DUF3265 domain-containing protein	-
OOK74_RS12470	209073..209342	-	270	WP_278183503.1	hypothetical protein	-
OOK74_RS12475	209426..209518	-	93	WP_140350947.1	DUF3265 domain-containing protein	-
OOK74_RS12480	209541..209909	-	369	WP_278183504.1	hypothetical protein	-
OOK74_RS12485	209911..210231	-	321	WP_219602343.1	hypothetical protein	-
OOK74_RS12490	210410..210538	-	129	WP_278183582.1	DUF3265 domain-containing protein	-
OOK74_RS12495	210539..210934	-	396	WP_278183505.1	DUF3465 domain-containing protein	-
OOK74_RS12500	211095..211340	-	246	WP_274722969.1	CopG family transcriptional regulator	-
OOK74_RS12505	211327..211593	-	267	WP_274722968.1	BrnT family toxin	-
OOK74_RS12510	211841..212425	-	585	WP_278183506.1	hypothetical protein	-
OOK74_RS12515	212542..212676	-	135	WP_278183583.1	DUF3265 domain-containing protein	-
OOK74_RS12520	212707..212859	-	153	WP_278183584.1	DUF645 family protein	-
OOK74_RS12525	213069..213185	-	117	WP_278183585.1	DUF3265 domain-containing protein	-
OOK74_RS12530	213186..213581	-	396	WP_278183507.1	DUF3465 domain-containing protein	-
OOK74_RS12535	213754..214056	-	303	WP_278183508.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
OOK74_RS12540	214044..214301	-	258	WP_278183509.1	type II toxin-antitoxin system Phd/YefM family antitoxin	Antitoxin
OOK74_RS12545	214549..214743	-	195	WP_278183586.1	DUF645 family protein	-
OOK74_RS12550	215467..215619	-	153	WP_278183587.1	DUF645 family protein	-
OOK74_RS12555	215829..215960	-	132	WP_278183510.1	DUF3265 domain-containing protein	-
OOK74_RS12560	215994..216146	-	153	WP_278183588.1	DUF645 family protein	-
OOK74_RS12565	216523..216711	-	189	WP_278183511.1	DUF645 family protein	-
OOK74_RS12570	216885..217013	-	129	WP_278183581.1	DUF3265 domain-containing protein	-
OOK74_RS12575	217386..217742	-	357	WP_274723709.1	DUF6404 family protein	-
OOK74_RS12580	217946..218098	-	153	WP_278183589.1	DUF645 family protein	-
OOK74_RS12585	218067..218360	-	294	WP_278183622.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Integron	qnrVC4	-	188538..263116	74578
	-	inside	Integron	-	-	188538..263116	74578

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (3-86)

Antitoxin

• Type II toxin-antitoxin system, antitoxin Phd/YefM (1-67)

Sequences

Toxin

Protein

• Length: 101 a.a.
• Molecular weight: 11659.56 Da
• Isoelectric Point: 4.6794

>T265650 WP_278183508.1 NZ_CP113242:c214056-213754 [Vibrio sp. gvc]
MAEIIWTEPALSDLNDIAEYIALENVIAAKLLVQTVFAKVERLADFPESGRIPSELEHLNYREVVVNPCRIFYSYDDKQV
CILFVMRAERDLRRLMLTKQ

Nucleotide

• Length: 303 bp

Antitoxin

Protein

• Length: 86 a.a.
• Molecular weight: 9766.37 Da
• Isoelectric Point: 9.6247

>AT265650 WP_278183509.1 NZ_CP113242:c214301-214044 [Vibrio sp. gvc]
MKVELVTSLKRQATKILADLHHTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADSRVVTHQNAKDRM
LKWLK

Nucleotide

• Length: 258 bp