Detailed information of TA system TA265648

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): /BrnT(toxin)
• Location: 196704..197202
• Replicon: chromosome
• Accession: NZ_CP113242
• Organism: Vibrio sp. gvc

Toxin (Protein)

• Gene name: -
• Uniprot ID: -
• Locus tag: OOK74_RS12360
• Protein ID: WP_277208558.1
• Coordinates: 196936..197202 (-)
• Length: 89 a.a.

Antitoxin (Protein)

• Gene name: -
• Uniprot ID: -
• Locus tag: OOK74_RS12355
• Protein ID: WP_274722969.1
• Coordinates: 196704..196949 (-)
• Length: 82 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OOK74_RS12290	191797..192294	+	498	WP_278183482.1	GNAT family N-acetyltransferase	-
OOK74_RS12295	192506..192727	+	222	WP_274723744.1	hypothetical protein	-
OOK74_RS12300	192720..193010	+	291	WP_166015494.1	type II toxin-antitoxin system RelE/ParE family toxin	-
OOK74_RS12305	193035..193145	-	111	WP_278183577.1	DUF3265 domain-containing protein	-
OOK74_RS12310	193153..193566	-	414	WP_278183483.1	VOC family protein	-
OOK74_RS12315	193641..193760	-	120	WP_278183578.1	DUF3265 domain-containing protein	-
OOK74_RS12320	193832..194284	+	453	WP_278183484.1	DUF2384 domain-containing protein	-
OOK74_RS12325	194284..194754	+	471	WP_278183485.1	RES family NAD+ phosphorylase	-
OOK74_RS12330	194942..194986	-	45	Protein_177	hypothetical protein	-
OOK74_RS12335	195471..195755	+	285	WP_278183486.1	damage-inducible protein J	-
OOK74_RS12340	195752..196030	+	279	WP_278183487.1	type II toxin-antitoxin system RelE/ParE family toxin	-
OOK74_RS12345	196088..196183	-	96	WP_274723413.1	DUF3265 domain-containing protein	-
OOK74_RS12350	196226..196363	-	138	WP_278183579.1	DUF645 family protein	-
OOK74_RS12355	196704..196949	-	246	WP_274722969.1	CopG family transcriptional regulator	Antitoxin
OOK74_RS12360	196936..197202	-	267	WP_277208558.1	BrnT family toxin	Toxin
OOK74_RS12365	197269..197397	-	129	WP_274723043.1	DUF3265 domain-containing protein	-
OOK74_RS12370	197767..198480	-	714	WP_278183488.1	hypothetical protein	-
OOK74_RS12375	198683..198805	-	123	WP_278183580.1	DUF645 family protein	-
OOK74_RS12380	199160..199537	-	378	WP_278183489.1	hypothetical protein	-
OOK74_RS12385	199563..199694	-	132	WP_278183490.1	DUF3265 domain-containing protein	-
OOK74_RS12390	199728..199880	-	153	WP_278183491.1	DUF645 family protein	-
OOK74_RS12395	200197..200583	-	387	WP_278183493.1	VOC family protein	-
OOK74_RS12400	200622..200750	-	129	WP_274723730.1	DUF3265 domain-containing protein	-
OOK74_RS12405	201127..201642	-	516	WP_278183494.1	ClbS/DfsB family four-helix bundle protein	-
OOK74_RS12410	201748..202128	-	381	WP_278183495.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	181426..206243	24817
	-	inside	Integron	qnrVC4	-	188538..263116	74578
	-	inside	Integron	-	-	188538..263116	74578

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Ribonuclease toxin, BrnT, of type II toxin-antitoxin system (6-81)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 89 a.a.
• Molecular weight: 10164.47 Da
• Isoelectric Point: 6.7253

>T265648 WP_277208558.1 NZ_CP113242:c197202-196936 [Vibrio sp. gvc]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGMNIRLISVRRSRKA
EIDLYESA

Nucleotide

• Length: 267 bp

Antitoxin

Protein

• Length: 82 a.a.
• Molecular weight: 9517.85 Da
• Isoelectric Point: 6.4832

>AT265648 WP_274722969.1 NZ_CP113242:c196949-196704 [Vibrio sp. gvc]
MKAHEFDAKFESDDDDILMDLDLSQVKRPMHKQKRVNVDFPAWMLESLDREANRVGVTRQSIIKIWLAERLESVSHHASV
R

Nucleotide

• Length: 246 bp