Detailed information of TA system TA265647

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): relBE/RelE-RelB
• Location: 195471..196030
• Replicon: chromosome
• Accession: NZ_CP113242
• Organism: Vibrio sp. gvc

Toxin (Protein)

• Gene name: relE
• Uniprot ID: -
• Locus tag: OOK74_RS12340
• Protein ID: WP_278183487.1
• Coordinates: 195752..196030 (+)
• Length: 93 a.a.

Antitoxin (Protein)

• Gene name: relB
• Uniprot ID: -
• Locus tag: OOK74_RS12335
• Protein ID: WP_278183486.1
• Coordinates: 195471..195755 (+)
• Length: 95 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OOK74_RS12275	190764..190889	-	126	WP_278183576.1	DUF3265 domain-containing protein	-
OOK74_RS12280	190889..191236	-	348	WP_000885699.1	DUF3024 domain-containing protein	-
OOK74_RS12285	191528..191800	+	273	WP_274723737.1	DUF1778 domain-containing protein	-
OOK74_RS12290	191797..192294	+	498	WP_278183482.1	GNAT family N-acetyltransferase	-
OOK74_RS12295	192506..192727	+	222	WP_274723744.1	hypothetical protein	-
OOK74_RS12300	192720..193010	+	291	WP_166015494.1	type II toxin-antitoxin system RelE/ParE family toxin	-
OOK74_RS12305	193035..193145	-	111	WP_278183577.1	DUF3265 domain-containing protein	-
OOK74_RS12310	193153..193566	-	414	WP_278183483.1	VOC family protein	-
OOK74_RS12315	193641..193760	-	120	WP_278183578.1	DUF3265 domain-containing protein	-
OOK74_RS12320	193832..194284	+	453	WP_278183484.1	DUF2384 domain-containing protein	-
OOK74_RS12325	194284..194754	+	471	WP_278183485.1	RES family NAD+ phosphorylase	-
OOK74_RS12330	194942..194986	-	45	Protein_177	hypothetical protein	-
OOK74_RS12335	195471..195755	+	285	WP_278183486.1	damage-inducible protein J	Antitoxin
OOK74_RS12340	195752..196030	+	279	WP_278183487.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
OOK74_RS12345	196088..196183	-	96	WP_274723413.1	DUF3265 domain-containing protein	-
OOK74_RS12350	196226..196363	-	138	WP_278183579.1	DUF645 family protein	-
OOK74_RS12355	196704..196949	-	246	WP_274722969.1	CopG family transcriptional regulator	-
OOK74_RS12360	196936..197202	-	267	WP_277208558.1	BrnT family toxin	-
OOK74_RS12365	197269..197397	-	129	WP_274723043.1	DUF3265 domain-containing protein	-
OOK74_RS12370	197767..198480	-	714	WP_278183488.1	hypothetical protein	-
OOK74_RS12375	198683..198805	-	123	WP_278183580.1	DUF645 family protein	-
OOK74_RS12380	199160..199537	-	378	WP_278183489.1	hypothetical protein	-
OOK74_RS12385	199563..199694	-	132	WP_278183490.1	DUF3265 domain-containing protein	-
OOK74_RS12390	199728..199880	-	153	WP_278183491.1	DUF645 family protein	-
OOK74_RS12395	200197..200583	-	387	WP_278183493.1	VOC family protein	-
OOK74_RS12400	200622..200750	-	129	WP_274723730.1	DUF3265 domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	181426..206243	24817
	-	inside	Integron	qnrVC4	-	188538..263116	74578
	-	inside	Integron	-	-	188538..263116	74578

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (2-89)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 93 a.a.
• Molecular weight: 10884.54 Da
• Isoelectric Point: 4.5216

>T265647 WP_278183487.1 NZ_CP113242:195752-196030 [Vibrio sp. gvc]
MIFWEETSLNDREKIFEFLYDFNPAAAEKTDELIETKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVDGSNIRIM
RVLHQKQKFPND

Nucleotide

• Length: 279 bp

Antitoxin

Protein

• Length: 95 a.a.
• Molecular weight: 10896.27 Da
• Isoelectric Point: 10.3809

>AT265647 WP_278183486.1 NZ_CP113242:195471-195755 [Vibrio sp. gvc]
MDTRIQFRVNEETKRLAQQMAESQGRTLSDACRELTKQLAEQQRKALSHDAWLTEQVNQAFETFDSGKSVFVEHDITKAR
MAERKAKIRSRGRA

Nucleotide

• Length: 285 bp