Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /GNAT-DUF1778
Location 191528..192294 Replicon chromosome
Accession NZ_CP113242
Organism Vibrio sp. gvc

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag OOK74_RS12290 Protein ID WP_278183482.1
Coordinates 191797..192294 (+) Length 166 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag OOK74_RS12285 Protein ID WP_274723737.1
Coordinates 191528..191800 (+) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OOK74_RS12230 187142..187645 - 504 WP_278183478.1 Arm DNA-binding domain-containing protein -
OOK74_RS12235 187795..188541 - 747 WP_278183479.1 IS3 family transposase -
OOK74_RS12240 188538..188846 - 309 WP_274722970.1 transposase -
OOK74_RS12245 188928..189038 - 111 Protein_160 DUF3265 domain-containing protein -
OOK74_RS12250 189044..189409 - 366 WP_217520006.1 hypothetical protein -
OOK74_RS12255 189689..189937 + 249 WP_278183480.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
OOK74_RS12260 189927..190217 + 291 WP_274723680.1 type II toxin-antitoxin system RelE/ParE family toxin -
OOK74_RS12265 190264..190359 - 96 WP_278183575.1 DUF3265 domain-containing protein -
OOK74_RS12270 190401..190553 - 153 WP_278183481.1 DUF645 family protein -
OOK74_RS12275 190764..190889 - 126 WP_278183576.1 DUF3265 domain-containing protein -
OOK74_RS12280 190889..191236 - 348 WP_000885699.1 DUF3024 domain-containing protein -
OOK74_RS12285 191528..191800 + 273 WP_274723737.1 DUF1778 domain-containing protein Antitoxin
OOK74_RS12290 191797..192294 + 498 WP_278183482.1 GNAT family N-acetyltransferase Toxin
OOK74_RS12295 192506..192727 + 222 WP_274723744.1 hypothetical protein -
OOK74_RS12300 192720..193010 + 291 WP_166015494.1 type II toxin-antitoxin system RelE/ParE family toxin -
OOK74_RS12305 193035..193145 - 111 WP_278183577.1 DUF3265 domain-containing protein -
OOK74_RS12310 193153..193566 - 414 WP_278183483.1 VOC family protein -
OOK74_RS12315 193641..193760 - 120 WP_278183578.1 DUF3265 domain-containing protein -
OOK74_RS12320 193832..194284 + 453 WP_278183484.1 DUF2384 domain-containing protein -
OOK74_RS12325 194284..194754 + 471 WP_278183485.1 RES family NAD+ phosphorylase -
OOK74_RS12330 194942..194986 - 45 Protein_177 hypothetical protein -
OOK74_RS12335 195471..195755 + 285 WP_278183486.1 damage-inducible protein J -
OOK74_RS12340 195752..196030 + 279 WP_278183487.1 type II toxin-antitoxin system RelE/ParE family toxin -
OOK74_RS12345 196088..196183 - 96 WP_274723413.1 DUF3265 domain-containing protein -
OOK74_RS12350 196226..196363 - 138 WP_278183579.1 DUF645 family protein -
OOK74_RS12355 196704..196949 - 246 WP_274722969.1 CopG family transcriptional regulator -
OOK74_RS12360 196936..197202 - 267 WP_277208558.1 BrnT family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 181426..206243 24817
- inside Integron qnrVC4 - 188538..263116 74578
- inside Integron - - 188538..263116 74578


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(85-152)

Antitoxin

Vibrio phage ICP1, Orf50

(7-86)


Sequences

Toxin        


Download         Length: 166 a.a.        Molecular weight: 18639.35 Da        Isoelectric Point: 8.8085

>T265646 WP_278183482.1 NZ_CP113242:191797-192294 [Vibrio sp. gvc]
MMNTVLLDKDKHDRNRFNCGIEALNNYLKVMSSQQAKKDNTRTFVLEDDNNNTHIIGFYTLTMTPIDLKALPDKLQKKHQ
LSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RANLG

Download         Length: 498 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 9821.38 Da        Isoelectric Point: 8.5181

>AT265646 WP_274723737.1 NZ_CP113242:191528-191800 [Vibrio sp. gvc]
MATTLPRITARVDVDTQYLLTKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQADALLLMEALDNPATINTKLKL
ASERYESKTQ

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References