Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /GNAT-DUF1778 |
| Location | 191528..192294 | Replicon | chromosome |
| Accession | NZ_CP113242 | ||
| Organism | Vibrio sp. gvc | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | OOK74_RS12290 | Protein ID | WP_278183482.1 |
| Coordinates | 191797..192294 (+) | Length | 166 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | OOK74_RS12285 | Protein ID | WP_274723737.1 |
| Coordinates | 191528..191800 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OOK74_RS12230 | 187142..187645 | - | 504 | WP_278183478.1 | Arm DNA-binding domain-containing protein | - |
| OOK74_RS12235 | 187795..188541 | - | 747 | WP_278183479.1 | IS3 family transposase | - |
| OOK74_RS12240 | 188538..188846 | - | 309 | WP_274722970.1 | transposase | - |
| OOK74_RS12245 | 188928..189038 | - | 111 | Protein_160 | DUF3265 domain-containing protein | - |
| OOK74_RS12250 | 189044..189409 | - | 366 | WP_217520006.1 | hypothetical protein | - |
| OOK74_RS12255 | 189689..189937 | + | 249 | WP_278183480.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| OOK74_RS12260 | 189927..190217 | + | 291 | WP_274723680.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| OOK74_RS12265 | 190264..190359 | - | 96 | WP_278183575.1 | DUF3265 domain-containing protein | - |
| OOK74_RS12270 | 190401..190553 | - | 153 | WP_278183481.1 | DUF645 family protein | - |
| OOK74_RS12275 | 190764..190889 | - | 126 | WP_278183576.1 | DUF3265 domain-containing protein | - |
| OOK74_RS12280 | 190889..191236 | - | 348 | WP_000885699.1 | DUF3024 domain-containing protein | - |
| OOK74_RS12285 | 191528..191800 | + | 273 | WP_274723737.1 | DUF1778 domain-containing protein | Antitoxin |
| OOK74_RS12290 | 191797..192294 | + | 498 | WP_278183482.1 | GNAT family N-acetyltransferase | Toxin |
| OOK74_RS12295 | 192506..192727 | + | 222 | WP_274723744.1 | hypothetical protein | - |
| OOK74_RS12300 | 192720..193010 | + | 291 | WP_166015494.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| OOK74_RS12305 | 193035..193145 | - | 111 | WP_278183577.1 | DUF3265 domain-containing protein | - |
| OOK74_RS12310 | 193153..193566 | - | 414 | WP_278183483.1 | VOC family protein | - |
| OOK74_RS12315 | 193641..193760 | - | 120 | WP_278183578.1 | DUF3265 domain-containing protein | - |
| OOK74_RS12320 | 193832..194284 | + | 453 | WP_278183484.1 | DUF2384 domain-containing protein | - |
| OOK74_RS12325 | 194284..194754 | + | 471 | WP_278183485.1 | RES family NAD+ phosphorylase | - |
| OOK74_RS12330 | 194942..194986 | - | 45 | Protein_177 | hypothetical protein | - |
| OOK74_RS12335 | 195471..195755 | + | 285 | WP_278183486.1 | damage-inducible protein J | - |
| OOK74_RS12340 | 195752..196030 | + | 279 | WP_278183487.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| OOK74_RS12345 | 196088..196183 | - | 96 | WP_274723413.1 | DUF3265 domain-containing protein | - |
| OOK74_RS12350 | 196226..196363 | - | 138 | WP_278183579.1 | DUF645 family protein | - |
| OOK74_RS12355 | 196704..196949 | - | 246 | WP_274722969.1 | CopG family transcriptional regulator | - |
| OOK74_RS12360 | 196936..197202 | - | 267 | WP_277208558.1 | BrnT family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 181426..206243 | 24817 | |
| - | inside | Integron | qnrVC4 | - | 188538..263116 | 74578 | |
| - | inside | Integron | - | - | 188538..263116 | 74578 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 18639.35 Da Isoelectric Point: 8.8085
>T265646 WP_278183482.1 NZ_CP113242:191797-192294 [Vibrio sp. gvc]
MMNTVLLDKDKHDRNRFNCGIEALNNYLKVMSSQQAKKDNTRTFVLEDDNNNTHIIGFYTLTMTPIDLKALPDKLQKKHQ
LSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RANLG
MMNTVLLDKDKHDRNRFNCGIEALNNYLKVMSSQQAKKDNTRTFVLEDDNNNTHIIGFYTLTMTPIDLKALPDKLQKKHQ
LSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RANLG
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|