Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 2258825..2259426 | Replicon | chromosome |
| Accession | NZ_CP113236 | ||
| Organism | Pasteurella multocida strain PF8 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | ORU23_RS10980 | Protein ID | WP_078819687.1 |
| Coordinates | 2258825..2259139 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | ORU23_RS10985 | Protein ID | WP_078819686.1 |
| Coordinates | 2259136..2259426 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORU23_RS10925 (ORU23_10925) | 2254415..2254702 | - | 288 | WP_014391452.1 | hypothetical protein | - |
| ORU23_RS10930 (ORU23_10930) | 2254715..2254951 | - | 237 | WP_075271355.1 | hypothetical protein | - |
| ORU23_RS10935 (ORU23_10935) | 2254923..2255222 | - | 300 | WP_078802174.1 | hypothetical protein | - |
| ORU23_RS10940 (ORU23_10940) | 2255370..2255600 | + | 231 | WP_223251317.1 | hypothetical protein | - |
| ORU23_RS10945 (ORU23_10945) | 2255662..2256318 | - | 657 | WP_225529682.1 | KilA-N domain-containing protein | - |
| ORU23_RS10950 (ORU23_10950) | 2256568..2256936 | - | 369 | Protein_2111 | Bro-N domain-containing protein | - |
| ORU23_RS10955 (ORU23_10955) | 2257300..2257494 | + | 195 | WP_014391459.1 | hypothetical protein | - |
| ORU23_RS10960 (ORU23_10960) | 2257475..2257645 | - | 171 | WP_225529669.1 | hypothetical protein | - |
| ORU23_RS10965 (ORU23_10965) | 2257658..2257888 | - | 231 | WP_078737821.1 | hypothetical protein | - |
| ORU23_RS10970 (ORU23_10970) | 2258130..2258339 | - | 210 | WP_005756656.1 | hypothetical protein | - |
| ORU23_RS10975 (ORU23_10975) | 2258352..2258519 | + | 168 | WP_005756653.1 | DUF1508 domain-containing protein | - |
| ORU23_RS10980 (ORU23_10980) | 2258825..2259139 | + | 315 | WP_078819687.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ORU23_RS10985 (ORU23_10985) | 2259136..2259426 | + | 291 | WP_078819686.1 | putative addiction module antidote protein | Antitoxin |
| ORU23_RS10990 (ORU23_10990) | 2259452..2259856 | - | 405 | WP_146024473.1 | hypothetical protein | - |
| ORU23_RS10995 (ORU23_10995) | 2259886..2261730 | - | 1845 | WP_071523830.1 | DEAD/DEAH box helicase family protein | - |
| ORU23_RS11000 (ORU23_11000) | 2261941..2262624 | - | 684 | WP_099821842.1 | S24 family peptidase | - |
| ORU23_RS11005 (ORU23_11005) | 2262749..2262949 | + | 201 | WP_099821841.1 | YdaS family helix-turn-helix protein | - |
| ORU23_RS11010 (ORU23_11010) | 2262998..2263447 | + | 450 | WP_099821840.1 | YmfL family putative regulatory protein | - |
| ORU23_RS11015 (ORU23_11015) | 2263505..2264188 | + | 684 | WP_014390721.1 | phage antirepressor KilAC domain-containing protein | - |
| ORU23_RS11020 (ORU23_11020) | 2264185..2264400 | + | 216 | WP_075271368.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2246345..2294505 | 48160 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11763.65 Da Isoelectric Point: 9.5553
>T265643 WP_078819687.1 NZ_CP113236:2258825-2259139 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|