265643

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/upstrm_HI1419-dnstrm_HI1420
Location 2258825..2259426 Replicon chromosome
Accession NZ_CP113236
Organism Pasteurella multocida strain PF8

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag ORU23_RS10980 Protein ID WP_078819687.1
Coordinates 2258825..2259139 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag ORU23_RS10985 Protein ID WP_078819686.1
Coordinates 2259136..2259426 (+) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORU23_RS10925 (ORU23_10925) 2254415..2254702 - 288 WP_014391452.1 hypothetical protein -
ORU23_RS10930 (ORU23_10930) 2254715..2254951 - 237 WP_075271355.1 hypothetical protein -
ORU23_RS10935 (ORU23_10935) 2254923..2255222 - 300 WP_078802174.1 hypothetical protein -
ORU23_RS10940 (ORU23_10940) 2255370..2255600 + 231 WP_223251317.1 hypothetical protein -
ORU23_RS10945 (ORU23_10945) 2255662..2256318 - 657 WP_225529682.1 KilA-N domain-containing protein -
ORU23_RS10950 (ORU23_10950) 2256568..2256936 - 369 Protein_2111 Bro-N domain-containing protein -
ORU23_RS10955 (ORU23_10955) 2257300..2257494 + 195 WP_014391459.1 hypothetical protein -
ORU23_RS10960 (ORU23_10960) 2257475..2257645 - 171 WP_225529669.1 hypothetical protein -
ORU23_RS10965 (ORU23_10965) 2257658..2257888 - 231 WP_078737821.1 hypothetical protein -
ORU23_RS10970 (ORU23_10970) 2258130..2258339 - 210 WP_005756656.1 hypothetical protein -
ORU23_RS10975 (ORU23_10975) 2258352..2258519 + 168 WP_005756653.1 DUF1508 domain-containing protein -
ORU23_RS10980 (ORU23_10980) 2258825..2259139 + 315 WP_078819687.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
ORU23_RS10985 (ORU23_10985) 2259136..2259426 + 291 WP_078819686.1 putative addiction module antidote protein Antitoxin
ORU23_RS10990 (ORU23_10990) 2259452..2259856 - 405 WP_146024473.1 hypothetical protein -
ORU23_RS10995 (ORU23_10995) 2259886..2261730 - 1845 WP_071523830.1 DEAD/DEAH box helicase family protein -
ORU23_RS11000 (ORU23_11000) 2261941..2262624 - 684 WP_099821842.1 S24 family peptidase -
ORU23_RS11005 (ORU23_11005) 2262749..2262949 + 201 WP_099821841.1 YdaS family helix-turn-helix protein -
ORU23_RS11010 (ORU23_11010) 2262998..2263447 + 450 WP_099821840.1 YmfL family putative regulatory protein -
ORU23_RS11015 (ORU23_11015) 2263505..2264188 + 684 WP_014390721.1 phage antirepressor KilAC domain-containing protein -
ORU23_RS11020 (ORU23_11020) 2264185..2264400 + 216 WP_075271368.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2246345..2294505 48160


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-97)

Antitoxin

Cro/C1-type helix-turn-helix domain

(47-91)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11763.65 Da        Isoelectric Point: 9.5553

>T265643 WP_078819687.1 NZ_CP113236:2258825-2259139 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV

Download         Length: 315 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10574.22 Da        Isoelectric Point: 5.7134

>AT265643 WP_078819686.1 NZ_CP113236:2259136-2259426 [Pasteurella multocida]
MSKKVELKPFDIAEYLDSEEMIAAYLSEILETGDTNEFISALGDVARARGMTELAAKTGLGRESLYKTLSHGSKPRFDTI
MKITQALGIKLVPTHI

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References