Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | TscAT/- |
Location | 410430..410959 | Replicon | chromosome |
Accession | NZ_CP113231 | ||
Organism | Staphylococcus aureus strain BIAI 158 |
Toxin (Protein)
Gene name | TscT | Uniprot ID | K7ZRX6 |
Locus tag | OSZ57_RS01980 | Protein ID | WP_001103939.1 |
Coordinates | 410642..410959 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | TscA | Uniprot ID | X5IY59 |
Locus tag | OSZ57_RS01975 | Protein ID | WP_001058494.1 |
Coordinates | 410430..410639 (+) | Length | 70 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSZ57_RS01940 (406760) | 406760..407224 | + | 465 | WP_001085185.1 | SsrA-binding protein SmpB | - |
OSZ57_RS01950 (407787) | 407787..408893 | - | 1107 | WP_000149511.1 | tyrosine-type recombinase/integrase | - |
OSZ57_RS01955 (408883) | 408883..409686 | - | 804 | WP_000358990.1 | helix-turn-helix transcriptional regulator | - |
OSZ57_RS01960 (409822) | 409822..410025 | + | 204 | WP_001045296.1 | transcriptional regulator | - |
OSZ57_RS01965 (410061) | 410061..410279 | + | 219 | WP_000163544.1 | helix-turn-helix transcriptional regulator | - |
OSZ57_RS01970 (410291) | 410291..410437 | + | 147 | WP_000784885.1 | hypothetical protein | - |
OSZ57_RS01975 (410430) | 410430..410639 | + | 210 | WP_001058494.1 | hypothetical protein | Antitoxin |
OSZ57_RS01980 (410642) | 410642..410959 | + | 318 | WP_001103939.1 | DUF1474 family protein | Toxin |
OSZ57_RS01985 (411023) | 411023..411892 | + | 870 | WP_001002717.1 | primase alpha helix C-terminal domain-containing protein | - |
OSZ57_RS01990 (411909) | 411909..413366 | + | 1458 | WP_000390453.1 | virulence-associated E family protein | - |
OSZ57_RS01995 (413667) | 413667..414029 | + | 363 | WP_001039170.1 | hypothetical protein | - |
OSZ57_RS02000 (414031) | 414031..414315 | + | 285 | WP_000998185.1 | hypothetical protein | - |
OSZ57_RS02005 (414312) | 414312..414953 | + | 642 | WP_001019808.1 | hypothetical protein | - |
OSZ57_RS02010 (415200) | 415200..415334 | + | 135 | WP_256094151.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12547.17 Da Isoelectric Point: 5.0161
>T265637 WP_001103939.1 NZ_CP113231:410642-410959 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFGELIQKF
HEIEKASSENFGEVSDDAQKLKITE
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFGELIQKF
HEIEKASSENFGEVSDDAQKLKITE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|