Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 105511..106040 | Replicon | chromosome |
Accession | NZ_CP113231 | ||
Organism | Staphylococcus aureus strain BIAI 158 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | OSZ57_RS00515 | Protein ID | WP_000621175.1 |
Coordinates | 105678..106040 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | OSZ57_RS00510 | Protein ID | WP_000948331.1 |
Coordinates | 105511..105681 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OSZ57_RS00480 (100548) | 100548..101108 | + | 561 | WP_001092406.1 | K(+)-transporting ATPase subunit C | - |
OSZ57_RS00485 (101316) | 101316..101795 | + | 480 | WP_001287077.1 | hypothetical protein | - |
OSZ57_RS00490 (101788) | 101788..103371 | + | 1584 | WP_001294637.1 | PH domain-containing protein | - |
OSZ57_RS00495 (103358) | 103358..103849 | + | 492 | WP_001205907.1 | PH domain-containing protein | - |
OSZ57_RS00500 (103853) | 103853..104212 | + | 360 | WP_000581199.1 | holo-ACP synthase | - |
OSZ57_RS00505 (104278) | 104278..105426 | + | 1149 | WP_001281140.1 | alanine racemase | - |
OSZ57_RS00510 (105511) | 105511..105681 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
OSZ57_RS00515 (105678) | 105678..106040 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OSZ57_RS00520 (106389) | 106389..107390 | + | 1002 | WP_042744356.1 | PP2C family protein-serine/threonine phosphatase | - |
OSZ57_RS00525 (107509) | 107509..107835 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
OSZ57_RS00530 (107837) | 107837..108316 | + | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
OSZ57_RS00535 (108291) | 108291..109061 | + | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T265636 WP_000621175.1 NZ_CP113231:105678-106040 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|