Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 3022394..3023034 Replicon chromosome
Accession NZ_CP113230
Organism Pseudomonas aeruginosa strain BIAI 160

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag OSZ60_RS14410 Protein ID WP_003105740.1
Coordinates 3022624..3023034 (+) Length 137 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID Q6X2S2
Locus tag OSZ60_RS14405 Protein ID WP_003158175.1
Coordinates 3022394..3022624 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OSZ60_RS14390 (OSZ60_14390) 3017592..3019481 - 1890 WP_003105732.1 hypothetical protein -
OSZ60_RS14395 (OSZ60_14395) 3019702..3019911 - 210 WP_003105733.1 cold-shock protein -
OSZ60_RS14400 (OSZ60_14400) 3020219..3022138 - 1920 WP_004352838.1 type I DNA topoisomerase -
OSZ60_RS14405 (OSZ60_14405) 3022394..3022624 + 231 WP_003158175.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OSZ60_RS14410 (OSZ60_14410) 3022624..3023034 + 411 WP_003105740.1 tRNA(fMet)-specific endonuclease VapC Toxin
OSZ60_RS14415 (OSZ60_14415) 3023056..3023316 + 261 WP_003105742.1 hypothetical protein -
OSZ60_RS14420 (OSZ60_14420) 3023516..3023734 + 219 WP_003105747.1 hypothetical protein -
OSZ60_RS14425 (OSZ60_14425) 3023800..3023997 - 198 WP_003109353.1 CrpP family ICE-associated protein -
OSZ60_RS14430 (OSZ60_14430) 3024153..3024642 - 490 Protein_2847 single-stranded DNA-binding protein -
OSZ60_RS14435 (OSZ60_14435) 3024672..3025511 - 840 WP_003105750.1 Rha family transcriptional regulator -
OSZ60_RS14440 (OSZ60_14440) 3025558..3026106 - 549 WP_003105753.1 DUF3158 family protein -
OSZ60_RS14445 (OSZ60_14445) 3026112..3026840 - 729 WP_003105754.1 TIGR03761 family integrating conjugative element protein -
OSZ60_RS14450 (OSZ60_14450) 3026996..3027166 - 171 WP_003159716.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 2952547..3042606 90059


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-124)

Antitoxin

SpoVT-AbrB domain

(7-35)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 15450.81 Da        Isoelectric Point: 7.3233

>T265631 WP_003105740.1 NZ_CP113230:3022624-3023034 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVVPIV

Download         Length: 411 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8480.41 Da        Isoelectric Point: 4.2821

>AT265631 WP_003158175.1 NZ_CP113230:3022394-3022624 [Pseudomonas aeruginosa]
MEQGSVFQSNRSQAVRLPKAVALPDDVKRVDVVVVGRARIITPAGESWDSWFDGEGVTADFMAEREQPADQERETF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB Q6X2S2

References