Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 1578147..1578652 | Replicon | chromosome |
| Accession | NZ_CP113230 | ||
| Organism | Pseudomonas aeruginosa strain BIAI 160 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | OSZ60_RS07755 | Protein ID | WP_003083773.1 |
| Coordinates | 1578371..1578652 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | OSZ60_RS07750 | Protein ID | WP_003083775.1 |
| Coordinates | 1578147..1578374 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OSZ60_RS07725 (OSZ60_07725) | 1573165..1574658 | + | 1494 | WP_016263977.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
| OSZ60_RS07730 (OSZ60_07730) | 1574827..1576254 | + | 1428 | WP_267749919.1 | GABA permease | - |
| OSZ60_RS07735 (OSZ60_07735) | 1576336..1576677 | - | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| OSZ60_RS07740 (OSZ60_07740) | 1576750..1577250 | - | 501 | WP_003112629.1 | LEA type 2 family protein | - |
| OSZ60_RS07745 (OSZ60_07745) | 1577351..1577971 | + | 621 | WP_003101226.1 | hypothetical protein | - |
| OSZ60_RS07750 (OSZ60_07750) | 1578147..1578374 | + | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| OSZ60_RS07755 (OSZ60_07755) | 1578371..1578652 | + | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| OSZ60_RS07760 (OSZ60_07760) | 1578952..1579860 | + | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
| OSZ60_RS07765 (OSZ60_07765) | 1579892..1580302 | - | 411 | WP_003101225.1 | aegerolysin family protein | - |
| OSZ60_RS07770 (OSZ60_07770) | 1580482..1581216 | - | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
| OSZ60_RS07775 (OSZ60_07775) | 1581317..1582003 | - | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| OSZ60_RS07780 (OSZ60_07780) | 1582052..1583401 | - | 1350 | WP_079279937.1 | C4-dicarboxylate transporter DctA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T265629 WP_003083773.1 NZ_CP113230:1578371-1578652 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|