Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 87099..87835 Replicon plasmid pSCLC9-2_3
Accession NZ_CP113218
Organism Klebsiella pneumoniae strain SCLC9-2

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag OT489_RS28855 Protein ID WP_003026803.1
Coordinates 87353..87835 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag OT489_RS28850 Protein ID WP_003026799.1
Coordinates 87099..87365 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT489_RS28805 (OT489_28800) 83161..83523 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
OT489_RS28810 (OT489_28805) 83573..83923 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
OT489_RS28815 (OT489_28810) 84281..84550 + 270 WP_004152102.1 hypothetical protein -
OT489_RS28820 (OT489_28815) 84538..85113 + 576 WP_004152103.1 hypothetical protein -
OT489_RS28825 (OT489_28820) 85144..85638 + 495 WP_004152104.1 DNA-binding protein -
OT489_RS28830 (OT489_28825) 85682..86050 + 369 WP_004152105.1 hypothetical protein -
OT489_RS28835 (OT489_28830) 86084..86287 + 204 WP_004152106.1 HHA domain-containing protein -
OT489_RS28840 (OT489_28835) 86336..86593 + 258 WP_004152107.1 hypothetical protein -
OT489_RS28845 (OT489_28840) 86669..86923 + 255 WP_004152108.1 hypothetical protein -
OT489_RS28850 (OT489_28845) 87099..87365 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
OT489_RS28855 (OT489_28850) 87353..87835 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
OT489_RS28860 (OT489_28855) 88036..89439 + 1404 WP_001272054.1 ISNCY-like element ISKpn21 family transposase -
OT489_RS28865 (OT489_28860) 89468..90100 - 633 WP_001567369.1 hypothetical protein -
OT489_RS28870 (OT489_28865) 90289..91578 + 1290 Protein_103 ISNCY family transposase -
OT489_RS28875 (OT489_28870) 91598..92806 - 1209 WP_001339197.1 IS4-like element ISVsa5 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(D) / mph(A) / sul1 / qnrB91 / qacE / ARR-3 / catB3 / blaOXA-1 / aac(6')-Ib-cr / aac(3)-IVa / aph(4)-Ia / sul2 / floR / aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aph(3')-Ia / dfrA12 - 1..225748 225748


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T265626 WP_003026803.1 NZ_CP113218:87353-87835 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT265626 WP_003026799.1 NZ_CP113218:87099-87365 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References