Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 221406..221931 Replicon plasmid pSCLC9-2_2
Accession NZ_CP113217
Organism Klebsiella pneumoniae strain SCLC9-2

Toxin (Protein)


Gene name ccdB Uniprot ID A0A6S4YF27
Locus tag OT489_RS28120 Protein ID WP_025714517.1
Coordinates 221626..221931 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag OT489_RS28115 Protein ID WP_001568025.1
Coordinates 221406..221624 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT489_RS28075 (OT489_28070) 216565..217269 + 705 WP_001067858.1 IS6-like element IS26 family transposase -
OT489_RS28080 (OT489_28075) 217319..217393 - 75 Protein_227 IS6 family transposase -
OT489_RS28085 (OT489_28080) 217523..218338 + 816 WP_000018326.1 aminoglycoside O-phosphotransferase APH(3')-Ia -
OT489_RS28090 (OT489_28085) 218451..219155 + 705 WP_001067858.1 IS6-like element IS26 family transposase -
OT489_RS28095 (OT489_28090) 219206..220102 - 897 Protein_230 AAA family ATPase -
OT489_RS28100 (OT489_28095) 220176..220592 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin -
OT489_RS28105 (OT489_28100) 220589..220819 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin -
OT489_RS28110 (OT489_28105) 220776..221236 + 461 Protein_233 hypothetical protein -
OT489_RS28115 (OT489_28110) 221406..221624 + 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
OT489_RS28120 (OT489_28115) 221626..221931 + 306 WP_025714517.1 type II toxin-antitoxin system toxin CcdB Toxin
OT489_RS28125 (OT489_28120) 222100..222495 + 396 WP_017899885.1 hypothetical protein -
OT489_RS28130 (OT489_28125) 222522..222836 + 315 WP_053389906.1 hypothetical protein -
OT489_RS28135 (OT489_28130) 223131..223847 + 717 Protein_238 hypothetical protein -
OT489_RS28140 (OT489_28135) 224045..224839 + 795 WP_004197635.1 site-specific integrase -
OT489_RS28145 (OT489_28140) 225279..225581 - 303 WP_071571079.1 hypothetical protein -
OT489_RS28150 (OT489_28145) 225578..226204 - 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(6)-Id / aph(3'')-Ib / qnrB4 / blaDHA-1 / sul1 / armA / msr(E) / mph(E) / aph(3')-Ia - 1..254258 254258


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11562.25 Da        Isoelectric Point: 5.6906

>T265625 WP_025714517.1 NZ_CP113217:221626-221931 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSCELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT265625 WP_001568025.1 NZ_CP113217:221406-221624 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6S4YF27

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References