Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 4779199..4779902 | Replicon | chromosome |
| Accession | NZ_CP113216 | ||
| Organism | Klebsiella pneumoniae strain SCLC9-2 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | OT489_RS23875 | Protein ID | WP_065803899.1 |
| Coordinates | 4779199..4779540 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A377WBK0 |
| Locus tag | OT489_RS23880 | Protein ID | WP_053274373.1 |
| Coordinates | 4779561..4779902 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OT489_RS23845 (4774221) | 4774221..4774487 | + | 267 | WP_004178415.1 | hypothetical protein | - |
| OT489_RS23850 (4774487) | 4774487..4775159 | + | 673 | Protein_4675 | DUF4400 domain-containing protein | - |
| OT489_RS23855 (4775170) | 4775170..4776054 | + | 885 | WP_004192285.1 | RES domain-containing protein | - |
| OT489_RS23860 (4776253) | 4776253..4776441 | - | 189 | Protein_4677 | transposase | - |
| OT489_RS23865 (4776458) | 4776458..4777569 | - | 1112 | Protein_4678 | IS3 family transposase | - |
| OT489_RS23870 (4777937) | 4777937..4778944 | - | 1008 | WP_004108748.1 | restriction endonuclease | - |
| OT489_RS23875 (4779199) | 4779199..4779540 | - | 342 | WP_065803899.1 | TA system toxin CbtA family protein | Toxin |
| OT489_RS23880 (4779561) | 4779561..4779902 | - | 342 | WP_053274373.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| OT489_RS23885 (4779913) | 4779913..4780455 | - | 543 | WP_065803898.1 | DNA repair protein RadC | - |
| OT489_RS23890 (4780468) | 4780468..4780908 | - | 441 | WP_039567646.1 | antirestriction protein | - |
| OT489_RS23895 (4780939) | 4780939..4781760 | - | 822 | WP_065803897.1 | DUF932 domain-containing protein | - |
| OT489_RS23900 (4781859) | 4781859..4782080 | - | 222 | WP_065803896.1 | DUF905 domain-containing protein | - |
| OT489_RS23905 (4782152) | 4782152..4782601 | - | 450 | WP_071571046.1 | IrmA family protein | - |
| OT489_RS23910 (4782598) | 4782598..4783050 | - | 453 | WP_065803894.1 | hypothetical protein | - |
| OT489_RS23915 (4783087) | 4783087..4783656 | - | 570 | WP_004929046.1 | hypothetical protein | - |
| OT489_RS23920 (4783656) | 4783656..4784360 | - | 705 | WP_065803893.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4768332..4805667 | 37335 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12756.74 Da Isoelectric Point: 9.0089
>T265619 WP_065803899.1 NZ_CP113216:c4779540-4779199 [Klebsiella pneumoniae]
MKTLPATTPQAVTLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIHEHIDAGISLADAVNFLVEKYGLVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAR
MKTLPATTPQAVTLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIHEHIDAGISLADAVNFLVEKYGLVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|