Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yfjZ/CbtA-CbeA
Location 4779199..4779902 Replicon chromosome
Accession NZ_CP113216
Organism Klebsiella pneumoniae strain SCLC9-2

Toxin (Protein)


Gene name ykfI Uniprot ID -
Locus tag OT489_RS23875 Protein ID WP_065803899.1
Coordinates 4779199..4779540 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID A0A377WBK0
Locus tag OT489_RS23880 Protein ID WP_053274373.1
Coordinates 4779561..4779902 (-) Length 114 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT489_RS23845 (4774221) 4774221..4774487 + 267 WP_004178415.1 hypothetical protein -
OT489_RS23850 (4774487) 4774487..4775159 + 673 Protein_4675 DUF4400 domain-containing protein -
OT489_RS23855 (4775170) 4775170..4776054 + 885 WP_004192285.1 RES domain-containing protein -
OT489_RS23860 (4776253) 4776253..4776441 - 189 Protein_4677 transposase -
OT489_RS23865 (4776458) 4776458..4777569 - 1112 Protein_4678 IS3 family transposase -
OT489_RS23870 (4777937) 4777937..4778944 - 1008 WP_004108748.1 restriction endonuclease -
OT489_RS23875 (4779199) 4779199..4779540 - 342 WP_065803899.1 TA system toxin CbtA family protein Toxin
OT489_RS23880 (4779561) 4779561..4779902 - 342 WP_053274373.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
OT489_RS23885 (4779913) 4779913..4780455 - 543 WP_065803898.1 DNA repair protein RadC -
OT489_RS23890 (4780468) 4780468..4780908 - 441 WP_039567646.1 antirestriction protein -
OT489_RS23895 (4780939) 4780939..4781760 - 822 WP_065803897.1 DUF932 domain-containing protein -
OT489_RS23900 (4781859) 4781859..4782080 - 222 WP_065803896.1 DUF905 domain-containing protein -
OT489_RS23905 (4782152) 4782152..4782601 - 450 WP_071571046.1 IrmA family protein -
OT489_RS23910 (4782598) 4782598..4783050 - 453 WP_065803894.1 hypothetical protein -
OT489_RS23915 (4783087) 4783087..4783656 - 570 WP_004929046.1 hypothetical protein -
OT489_RS23920 (4783656) 4783656..4784360 - 705 WP_065803893.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4768332..4805667 37335


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-109)

Antitoxin

Antitoxin CbeA

(13-112)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12756.74 Da        Isoelectric Point: 9.0089

>T265619 WP_065803899.1 NZ_CP113216:c4779540-4779199 [Klebsiella pneumoniae]
MKTLPATTPQAVTLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIHEHIDAGISLADAVNFLVEKYGLVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAR

Download         Length: 342 bp

Antitoxin


Download         Length: 114 a.a.        Molecular weight: 12773.41 Da        Isoelectric Point: 6.6253

>AT265619 WP_053274373.1 NZ_CP113216:c4779902-4779561 [Klebsiella pneumoniae]
MKSTDSENDSFLKWGLNRNVTPCFGARLVQEGNRLHYLADRASITGKFSEAECLKLDVAFPHFISQMESMLTTGEMNPRH
AHCVTLYHNGFTCEADTLGSYGYVYIAVYPTQR

Download         Length: 342 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A377WBK0

References