Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4137465..4138084 Replicon chromosome
Accession NZ_CP113216
Organism Klebsiella pneumoniae strain SCLC9-2

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OT489_RS20760 Protein ID WP_002892050.1
Coordinates 4137866..4138084 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OT489_RS20755 Protein ID WP_002892066.1
Coordinates 4137465..4137839 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT489_RS20745 (4132617) 4132617..4133810 + 1194 WP_100756986.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OT489_RS20750 (4133833) 4133833..4136979 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OT489_RS20755 (4137465) 4137465..4137839 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OT489_RS20760 (4137866) 4137866..4138084 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OT489_RS20765 (4138243) 4138243..4138809 + 567 WP_002892030.1 maltose O-acetyltransferase -
OT489_RS20770 (4138781) 4138781..4138921 - 141 WP_004147370.1 hypothetical protein -
OT489_RS20775 (4138942) 4138942..4139412 + 471 WP_002892026.1 YlaC family protein -
OT489_RS20780 (4139387) 4139387..4140838 - 1452 WP_021313732.1 PLP-dependent aminotransferase family protein -
OT489_RS20785 (4140939) 4140939..4141637 + 699 WP_002892021.1 GNAT family protein -
OT489_RS20790 (4141634) 4141634..4141774 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OT489_RS20795 (4141774) 4141774..4142037 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T265617 WP_002892050.1 NZ_CP113216:4137866-4138084 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT265617 WP_002892066.1 NZ_CP113216:4137465-4137839 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References