Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 22043..22686 Replicon plasmid pSYCC22-1_4
Accession NZ_CP113214
Organism Klebsiella pneumoniae strain SYCC22-1

Toxin (Protein)


Gene name vagD Uniprot ID Q84A06
Locus tag OT491_RS28235 Protein ID WP_000754566.1
Coordinates 22043..22459 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag OT491_RS28240 Protein ID WP_001261276.1
Coordinates 22456..22686 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT491_RS28215 (OT491_28215) 17571..18431 - 861 Protein_21 IS110 family transposase -
OT491_RS28220 (OT491_28220) 18713..18892 - 180 Protein_22 DDE-type integrase/transposase/recombinase -
OT491_RS28225 (OT491_28225) 18973..20481 - 1509 WP_001189111.1 group II intron reverse transcriptase/maturase -
OT491_RS28230 (OT491_28230) 21154..21839 - 686 Protein_24 IS3-like element ISEc15 family transposase -
OT491_RS28235 (OT491_28235) 22043..22459 - 417 WP_000754566.1 type II toxin-antitoxin system VapC family toxin Toxin
OT491_RS28240 (OT491_28240) 22456..22686 - 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OT491_RS28245 (OT491_28245) 23275..23568 + 294 WP_020956883.1 hypothetical protein -
OT491_RS28250 (OT491_28250) 23632..24318 + 687 WP_020956882.1 hypothetical protein -
OT491_RS28255 (OT491_28255) 24330..25106 + 777 WP_020956881.1 tyrosine-type recombinase/integrase -
OT491_RS28260 (OT491_28260) 25164..25421 - 258 WP_000764642.1 hypothetical protein -
OT491_RS28265 (OT491_28265) 25550..25654 - 105 WP_032409716.1 hypothetical protein -
OT491_RS28270 (OT491_28270) 26184..27050 + 867 WP_004118283.1 replication initiation protein -
OT491_RS28275 (OT491_28275) 27227..27496 - 270 WP_000339857.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid aph(3')-IIa / dfrA14 / tet(A) / blaOXA-181 / sul1 / qacE / aadA15 - 1..96379 96379


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15006.52 Da        Isoelectric Point: 9.2957

>T265605 WP_000754566.1 NZ_CP113214:c22459-22043 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT265605 WP_001261276.1 NZ_CP113214:c22686-22456 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A387K1G3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References