Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 54504..55240 | Replicon | plasmid pSYCC22-1_3 |
Accession | NZ_CP113213 | ||
Organism | Klebsiella pneumoniae strain SYCC22-1 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | L7SZ15 |
Locus tag | OT491_RS27280 | Protein ID | WP_003026803.1 |
Coordinates | 54758..55240 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | OT491_RS27275 | Protein ID | WP_003026799.1 |
Coordinates | 54504..54770 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OT491_RS27235 (OT491_27235) | 49733..50095 | - | 363 | WP_004152100.1 | arsenite efflux transporter metallochaperone ArsD | - |
OT491_RS27240 (OT491_27240) | 50145..50495 | - | 351 | WP_004152101.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
OT491_RS27245 (OT491_27245) | 50853..51101 | + | 249 | WP_001568018.1 | hypothetical protein | - |
OT491_RS27250 (OT491_27250) | 51098..51670 | + | 573 | WP_001568017.1 | hypothetical protein | - |
OT491_RS27255 (OT491_27255) | 51701..52195 | + | 495 | WP_001568016.1 | hypothetical protein | - |
OT491_RS27260 (OT491_27260) | 52428..52778 | - | 351 | WP_167878626.1 | hypothetical protein | - |
OT491_RS27265 (OT491_27265) | 53230..53778 | + | 549 | WP_001567366.1 | thioredoxin fold domain-containing protein | - |
OT491_RS27270 (OT491_27270) | 53825..54259 | + | 435 | WP_001567367.1 | cell envelope integrity protein TolA | - |
OT491_RS27275 (OT491_27275) | 54504..54770 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
OT491_RS27280 (OT491_27280) | 54758..55240 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
OT491_RS27285 (OT491_27285) | 55978..57222 | + | 1245 | WP_124053351.1 | hypothetical protein | - |
OT491_RS27290 (OT491_27290) | 57215..57970 | + | 756 | WP_100757158.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sul1 / qacE / aadA2 / blaTEM-1A / floR / aph(3')-Ia | - | 1..212905 | 212905 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T265604 WP_003026803.1 NZ_CP113213:54758-55240 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2GNW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |