Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3964142..3964761 Replicon chromosome
Accession NZ_CP113211
Organism Klebsiella pneumoniae strain SYCC22-1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OT491_RS19620 Protein ID WP_002892050.1
Coordinates 3964543..3964761 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OT491_RS19615 Protein ID WP_002892066.1
Coordinates 3964142..3964516 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT491_RS19605 (3959294) 3959294..3960487 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OT491_RS19610 (3960510) 3960510..3963656 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OT491_RS19615 (3964142) 3964142..3964516 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OT491_RS19620 (3964543) 3964543..3964761 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OT491_RS19625 (3964924) 3964924..3965490 + 567 WP_002892030.1 maltose O-acetyltransferase -
OT491_RS19630 (3965462) 3965462..3965602 - 141 WP_004147370.1 hypothetical protein -
OT491_RS19635 (3965623) 3965623..3966093 + 471 WP_002892026.1 YlaC family protein -
OT491_RS19640 (3966068) 3966068..3967519 - 1452 WP_064151794.1 PLP-dependent aminotransferase family protein -
OT491_RS19645 (3967620) 3967620..3968318 + 699 WP_002892021.1 GNAT family protein -
OT491_RS19650 (3968315) 3968315..3968455 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OT491_RS19655 (3968455) 3968455..3968718 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T265598 WP_002892050.1 NZ_CP113211:3964543-3964761 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT265598 WP_002892066.1 NZ_CP113211:3964142-3964516 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References