Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 12069..12712 Replicon plasmid pSCLC4-1_4
Accession NZ_CP113205
Organism Klebsiella pneumoniae strain SCLC4-1

Toxin (Protein)


Gene name vagD Uniprot ID Q84A06
Locus tag OT485_RS28385 Protein ID WP_000754566.1
Coordinates 12296..12712 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag OT485_RS28380 Protein ID WP_001261276.1
Coordinates 12069..12299 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT485_RS28345 (OT485_28350) 7259..7528 + 270 WP_000339857.1 hypothetical protein -
OT485_RS28350 (OT485_28355) 7705..8571 - 867 WP_004118283.1 replication initiation protein -
OT485_RS28355 (OT485_28360) 9101..9205 + 105 WP_032409716.1 hypothetical protein -
OT485_RS28360 (OT485_28365) 9334..9591 + 258 WP_000764642.1 hypothetical protein -
OT485_RS28365 (OT485_28370) 9649..10425 - 777 WP_020956881.1 tyrosine-type recombinase/integrase -
OT485_RS28370 (OT485_28375) 10437..11123 - 687 WP_020956882.1 hypothetical protein -
OT485_RS28375 (OT485_28380) 11187..11480 - 294 WP_020956883.1 hypothetical protein -
OT485_RS28380 (OT485_28385) 12069..12299 + 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OT485_RS28385 (OT485_28390) 12296..12712 + 417 WP_000754566.1 type II toxin-antitoxin system VapC family toxin Toxin
OT485_RS28390 (OT485_28395) 12916..13601 + 686 Protein_15 IS3-like element ISEc15 family transposase -
OT485_RS28395 (OT485_28400) 14274..15781 + 1508 Protein_16 group II intron reverse transcriptase/maturase -
OT485_RS28400 (OT485_28405) 15862..16041 + 180 Protein_17 DDE-type integrase/transposase/recombinase -
OT485_RS28405 (OT485_28410) 16323..17183 + 861 Protein_18 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid dfrA14 / aadA15 / qacE / sul1 / blaOXA-181 / tet(A) - 1..56294 56294


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15006.52 Da        Isoelectric Point: 9.2957

>T265589 WP_000754566.1 NZ_CP113205:12296-12712 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT265589 WP_001261276.1 NZ_CP113205:12069-12299 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A387K1G3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References