Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 54500..55236 | Replicon | plasmid pSCLC4-1_3 |
Accession | NZ_CP113204 | ||
Organism | Klebsiella pneumoniae strain SCLC4-1 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | L7SZ15 |
Locus tag | OT485_RS27490 | Protein ID | WP_003026803.1 |
Coordinates | 54754..55236 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | OT485_RS27485 | Protein ID | WP_003026799.1 |
Coordinates | 54500..54766 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OT485_RS27445 (OT485_27450) | 49729..50091 | - | 363 | WP_004152100.1 | arsenite efflux transporter metallochaperone ArsD | - |
OT485_RS27450 (OT485_27455) | 50141..50491 | - | 351 | WP_004152101.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
OT485_RS27455 (OT485_27460) | 50849..51097 | + | 249 | WP_001568018.1 | hypothetical protein | - |
OT485_RS27460 (OT485_27465) | 51094..51666 | + | 573 | WP_001568017.1 | hypothetical protein | - |
OT485_RS27465 (OT485_27470) | 51697..52191 | + | 495 | WP_001568016.1 | hypothetical protein | - |
OT485_RS27470 (OT485_27475) | 52424..52774 | - | 351 | WP_167878626.1 | hypothetical protein | - |
OT485_RS27475 (OT485_27480) | 53226..53774 | + | 549 | WP_001567366.1 | thioredoxin fold domain-containing protein | - |
OT485_RS27480 (OT485_27485) | 53821..54255 | + | 435 | WP_001567367.1 | cell envelope integrity protein TolA | - |
OT485_RS27485 (OT485_27490) | 54500..54766 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
OT485_RS27490 (OT485_27495) | 54754..55236 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
OT485_RS27495 (OT485_27500) | 55974..57218 | + | 1245 | WP_124053351.1 | hypothetical protein | - |
OT485_RS27500 (OT485_27505) | 57211..57966 | + | 756 | WP_100757158.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sul1 / qacE / aadA2 / blaTEM-1A / floR / aph(3')-Ia | - | 1..211765 | 211765 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T265588 WP_003026803.1 NZ_CP113204:54754-55236 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2GNW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |