Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3964151..3964770 Replicon chromosome
Accession NZ_CP113202
Organism Klebsiella pneumoniae strain SCLC4-1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OT485_RS19620 Protein ID WP_002892050.1
Coordinates 3964552..3964770 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OT485_RS19615 Protein ID WP_002892066.1
Coordinates 3964151..3964525 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT485_RS19605 (3959303) 3959303..3960496 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OT485_RS19610 (3960519) 3960519..3963665 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OT485_RS19615 (3964151) 3964151..3964525 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OT485_RS19620 (3964552) 3964552..3964770 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OT485_RS19625 (3964933) 3964933..3965499 + 567 WP_002892030.1 maltose O-acetyltransferase -
OT485_RS19630 (3965471) 3965471..3965611 - 141 WP_004147370.1 hypothetical protein -
OT485_RS19635 (3965632) 3965632..3966102 + 471 WP_002892026.1 YlaC family protein -
OT485_RS19640 (3966077) 3966077..3967528 - 1452 WP_064151794.1 PLP-dependent aminotransferase family protein -
OT485_RS19645 (3967629) 3967629..3968327 + 699 WP_002892021.1 GNAT family protein -
OT485_RS19650 (3968324) 3968324..3968464 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OT485_RS19655 (3968464) 3968464..3968727 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T265582 WP_002892050.1 NZ_CP113202:3964552-3964770 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT265582 WP_002892066.1 NZ_CP113202:3964151-3964525 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References