Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 163161..163897 | Replicon | plasmid pSCLC3-1_3 |
| Accession | NZ_CP113201 | ||
| Organism | Klebsiella pneumoniae strain SCLC3-1 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | OT487_RS28690 | Protein ID | WP_003026803.1 |
| Coordinates | 163415..163897 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | OT487_RS28685 | Protein ID | WP_003026799.1 |
| Coordinates | 163161..163427 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OT487_RS28645 (OT487_28645) | 158390..158752 | - | 363 | WP_004152100.1 | arsenite efflux transporter metallochaperone ArsD | - |
| OT487_RS28650 (OT487_28650) | 158802..159152 | - | 351 | WP_004152101.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| OT487_RS28655 (OT487_28655) | 159510..159758 | + | 249 | WP_001568018.1 | hypothetical protein | - |
| OT487_RS28660 (OT487_28660) | 159755..160327 | + | 573 | WP_001568017.1 | hypothetical protein | - |
| OT487_RS28665 (OT487_28665) | 160358..160852 | + | 495 | WP_001568016.1 | hypothetical protein | - |
| OT487_RS28670 (OT487_28670) | 161085..161435 | - | 351 | WP_167878626.1 | hypothetical protein | - |
| OT487_RS28675 (OT487_28675) | 161887..162435 | + | 549 | WP_001567366.1 | thioredoxin fold domain-containing protein | - |
| OT487_RS28680 (OT487_28680) | 162482..162916 | + | 435 | WP_001567367.1 | cell envelope integrity protein TolA | - |
| OT487_RS28685 (OT487_28685) | 163161..163427 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| OT487_RS28690 (OT487_28690) | 163415..163897 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| OT487_RS28695 (OT487_28695) | 164635..165879 | + | 1245 | WP_124053351.1 | hypothetical protein | - |
| OT487_RS28700 (OT487_28700) | 165872..166627 | + | 756 | WP_100757158.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA2 / blaTEM-1A / floR / aph(3')-Ia / sul1 / qacE | - | 1..211625 | 211625 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T265574 WP_003026803.1 NZ_CP113201:163415-163897 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |