Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 37210..37853 Replicon plasmid pSCLC3-1_4
Accession NZ_CP113198
Organism Klebsiella pneumoniae strain SCLC3-1

Toxin (Protein)


Gene name vagD Uniprot ID Q84A06
Locus tag OT487_RS25930 Protein ID WP_000754566.1
Coordinates 37437..37853 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag OT487_RS25925 Protein ID WP_001261276.1
Coordinates 37210..37440 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT487_RS25890 (OT487_25885) 32400..32669 + 270 WP_000339857.1 hypothetical protein -
OT487_RS25895 (OT487_25890) 32846..33712 - 867 WP_004118283.1 replication initiation protein -
OT487_RS25900 (OT487_25895) 34242..34346 + 105 WP_032409716.1 hypothetical protein -
OT487_RS25905 (OT487_25900) 34475..34732 + 258 WP_000764642.1 hypothetical protein -
OT487_RS25910 (OT487_25905) 34790..35566 - 777 WP_020956881.1 tyrosine-type recombinase/integrase -
OT487_RS25915 (OT487_25910) 35578..36264 - 687 WP_020956882.1 hypothetical protein -
OT487_RS25920 (OT487_25915) 36328..36621 - 294 WP_020956883.1 hypothetical protein -
OT487_RS25925 (OT487_25920) 37210..37440 + 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OT487_RS25930 (OT487_25925) 37437..37853 + 417 WP_000754566.1 type II toxin-antitoxin system VapC family toxin Toxin
OT487_RS25935 (OT487_25930) 38057..38742 + 686 Protein_39 IS3-like element ISEc15 family transposase -
OT487_RS25940 (OT487_25935) 39415..40923 + 1509 WP_001189111.1 group II intron reverse transcriptase/maturase -
OT487_RS25945 (OT487_25940) 41004..41183 + 180 Protein_41 DDE-type integrase/transposase/recombinase -
OT487_RS25950 (OT487_25945) 41465..42325 + 861 Protein_42 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaOXA-181 / tet(A) / dfrA14 / aadA15 / qacE / sul1 - 1..60224 60224


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15006.52 Da        Isoelectric Point: 9.2957

>T265571 WP_000754566.1 NZ_CP113198:37437-37853 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT265571 WP_001261276.1 NZ_CP113198:37210-37440 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A387K1G3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References