Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 37210..37853 | Replicon | plasmid pSCLC3-1_4 |
| Accession | NZ_CP113198 | ||
| Organism | Klebsiella pneumoniae strain SCLC3-1 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q84A06 |
| Locus tag | OT487_RS25930 | Protein ID | WP_000754566.1 |
| Coordinates | 37437..37853 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | OT487_RS25925 | Protein ID | WP_001261276.1 |
| Coordinates | 37210..37440 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OT487_RS25890 (OT487_25885) | 32400..32669 | + | 270 | WP_000339857.1 | hypothetical protein | - |
| OT487_RS25895 (OT487_25890) | 32846..33712 | - | 867 | WP_004118283.1 | replication initiation protein | - |
| OT487_RS25900 (OT487_25895) | 34242..34346 | + | 105 | WP_032409716.1 | hypothetical protein | - |
| OT487_RS25905 (OT487_25900) | 34475..34732 | + | 258 | WP_000764642.1 | hypothetical protein | - |
| OT487_RS25910 (OT487_25905) | 34790..35566 | - | 777 | WP_020956881.1 | tyrosine-type recombinase/integrase | - |
| OT487_RS25915 (OT487_25910) | 35578..36264 | - | 687 | WP_020956882.1 | hypothetical protein | - |
| OT487_RS25920 (OT487_25915) | 36328..36621 | - | 294 | WP_020956883.1 | hypothetical protein | - |
| OT487_RS25925 (OT487_25920) | 37210..37440 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OT487_RS25930 (OT487_25925) | 37437..37853 | + | 417 | WP_000754566.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OT487_RS25935 (OT487_25930) | 38057..38742 | + | 686 | Protein_39 | IS3-like element ISEc15 family transposase | - |
| OT487_RS25940 (OT487_25935) | 39415..40923 | + | 1509 | WP_001189111.1 | group II intron reverse transcriptase/maturase | - |
| OT487_RS25945 (OT487_25940) | 41004..41183 | + | 180 | Protein_41 | DDE-type integrase/transposase/recombinase | - |
| OT487_RS25950 (OT487_25945) | 41465..42325 | + | 861 | Protein_42 | IS110 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaOXA-181 / tet(A) / dfrA14 / aadA15 / qacE / sul1 | - | 1..60224 | 60224 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15006.52 Da Isoelectric Point: 9.2957
>T265571 WP_000754566.1 NZ_CP113198:37437-37853 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K1G3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |