Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4679430..4679946 | Replicon | chromosome |
| Accession | NZ_CP113197 | ||
| Organism | Klebsiella pneumoniae strain SCLC3-1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | OT487_RS23005 | Protein ID | WP_004178374.1 |
| Coordinates | 4679430..4679714 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | OT487_RS23010 | Protein ID | WP_002886901.1 |
| Coordinates | 4679704..4679946 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OT487_RS22980 (4674825) | 4674825..4675088 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
| OT487_RS22985 (4675218) | 4675218..4675391 | + | 174 | WP_032412860.1 | hypothetical protein | - |
| OT487_RS22990 (4675394) | 4675394..4676137 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| OT487_RS22995 (4676494) | 4676494..4678632 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| OT487_RS23000 (4678962) | 4678962..4679426 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| OT487_RS23005 (4679430) | 4679430..4679714 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OT487_RS23010 (4679704) | 4679704..4679946 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| OT487_RS23015 (4680024) | 4680024..4681934 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| OT487_RS23020 (4681957) | 4681957..4683111 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| OT487_RS23025 (4683178) | 4683178..4683918 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T265568 WP_004178374.1 NZ_CP113197:c4679714-4679430 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6THG1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |