Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3965876..3966495 | Replicon | chromosome |
| Accession | NZ_CP113197 | ||
| Organism | Klebsiella pneumoniae strain SCLC3-1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | OT487_RS19640 | Protein ID | WP_002892050.1 |
| Coordinates | 3966277..3966495 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | OT487_RS19635 | Protein ID | WP_002892066.1 |
| Coordinates | 3965876..3966250 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OT487_RS19625 (3961028) | 3961028..3962221 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| OT487_RS19630 (3962244) | 3962244..3965390 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| OT487_RS19635 (3965876) | 3965876..3966250 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| OT487_RS19640 (3966277) | 3966277..3966495 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| OT487_RS19645 (3966658) | 3966658..3967224 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| OT487_RS19650 (3967196) | 3967196..3967336 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| OT487_RS19655 (3967357) | 3967357..3967827 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| OT487_RS19660 (3967802) | 3967802..3969253 | - | 1452 | WP_064151794.1 | PLP-dependent aminotransferase family protein | - |
| OT487_RS19665 (3969354) | 3969354..3970052 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| OT487_RS19670 (3970049) | 3970049..3970189 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| OT487_RS19675 (3970189) | 3970189..3970452 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T265566 WP_002892050.1 NZ_CP113197:3966277-3966495 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT265566 WP_002892066.1 NZ_CP113197:3965876-3966250 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |