Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3965876..3966495 Replicon chromosome
Accession NZ_CP113197
Organism Klebsiella pneumoniae strain SCLC3-1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OT487_RS19640 Protein ID WP_002892050.1
Coordinates 3966277..3966495 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OT487_RS19635 Protein ID WP_002892066.1
Coordinates 3965876..3966250 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT487_RS19625 (3961028) 3961028..3962221 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OT487_RS19630 (3962244) 3962244..3965390 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OT487_RS19635 (3965876) 3965876..3966250 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OT487_RS19640 (3966277) 3966277..3966495 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OT487_RS19645 (3966658) 3966658..3967224 + 567 WP_002892030.1 maltose O-acetyltransferase -
OT487_RS19650 (3967196) 3967196..3967336 - 141 WP_004147370.1 hypothetical protein -
OT487_RS19655 (3967357) 3967357..3967827 + 471 WP_002892026.1 YlaC family protein -
OT487_RS19660 (3967802) 3967802..3969253 - 1452 WP_064151794.1 PLP-dependent aminotransferase family protein -
OT487_RS19665 (3969354) 3969354..3970052 + 699 WP_002892021.1 GNAT family protein -
OT487_RS19670 (3970049) 3970049..3970189 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OT487_RS19675 (3970189) 3970189..3970452 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T265566 WP_002892050.1 NZ_CP113197:3966277-3966495 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT265566 WP_002892066.1 NZ_CP113197:3965876-3966250 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References