Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-DnaT |
| Location | 273237..273759 | Replicon | plasmid pSXC4-2_tmex_350k |
| Accession | NZ_CP113193 | ||
| Organism | Klebsiella pneumoniae strain SXC4-2 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | A0A2J4R0S6 |
| Locus tag | OT483_RS27085 | Protein ID | WP_004181778.1 |
| Coordinates | 273475..273759 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | A0A5Q9LM53 |
| Locus tag | OT483_RS27080 | Protein ID | WP_025368601.1 |
| Coordinates | 273237..273485 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OT483_RS27060 (OT483_27060) | 268437..269273 | - | 837 | WP_227520814.1 | hypothetical protein | - |
| OT483_RS27065 (OT483_27065) | 269320..269673 | - | 354 | WP_004181774.1 | hypothetical protein | - |
| OT483_RS27070 (OT483_27070) | 269818..270813 | - | 996 | WP_046654939.1 | hypothetical protein | - |
| OT483_RS27075 (OT483_27075) | 271147..272946 | - | 1800 | WP_042935572.1 | ATP-dependent helicase | - |
| OT483_RS27080 (OT483_27080) | 273237..273485 | + | 249 | WP_025368601.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OT483_RS27085 (OT483_27085) | 273475..273759 | + | 285 | WP_004181778.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OT483_RS27090 (OT483_27090) | 273989..275215 | + | 1227 | WP_042935575.1 | RNA-guided endonuclease TnpB family protein | - |
| OT483_RS27095 (OT483_27095) | 275501..275926 | - | 426 | WP_040120489.1 | IS200/IS605 family transposase | - |
| OT483_RS27100 (OT483_27100) | 275963..277189 | + | 1227 | WP_025368604.1 | RNA-guided endonuclease TnpB family protein | - |
| OT483_RS27105 (OT483_27105) | 277255..278381 | - | 1127 | Protein_307 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aac(3)-IVa / aph(4)-Ia / aph(6)-Id / aph(3'')-Ib / aph(3')-Ia / mph(E) / msr(E) / armA / sul1 / qacE / dfrA12 / aph(3')-IIa / mph(A) / fosA3 / sul2 / tet(A) / floR / blaTEM-1B / rmtB / blaDHA-1 / qnrB4 | - | 1..350595 | 350595 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10970.69 Da Isoelectric Point: 10.6516
>T265558 WP_004181778.1 NZ_CP113193:273475-273759 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4R0S6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Q9LM53 |