Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 200996..201639 Replicon plasmid pSXC4-2_tmex_350k
Accession NZ_CP113193
Organism Klebsiella pneumoniae strain SXC4-2

Toxin (Protein)


Gene name vagD Uniprot ID B1LRW4
Locus tag OT483_RS26640 Protein ID WP_001044768.1
Coordinates 200996..201412 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D2WFK3
Locus tag OT483_RS26645 Protein ID WP_001261287.1
Coordinates 201409..201639 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT483_RS26620 (OT483_26620) 196779..197192 - 414 WP_267717701.1 AAA family ATPase -
OT483_RS26625 (OT483_26625) 197495..198085 - 591 WP_000194575.1 hypothetical protein -
OT483_RS26630 (OT483_26630) 198085..198342 - 258 WP_000343085.1 hypothetical protein -
OT483_RS26635 (OT483_26635) 198696..200834 + 2139 WP_000350638.1 AAA family ATPase -
OT483_RS26640 (OT483_26640) 200996..201412 - 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin Toxin
OT483_RS26645 (OT483_26645) 201409..201639 - 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OT483_RS26650 (OT483_26650) 201935..202225 + 291 WP_000111771.1 hypothetical protein -
OT483_RS26655 (OT483_26655) 202215..203114 + 900 WP_000963206.1 nucleotide-binding protein -
OT483_RS26660 (OT483_26660) 203164..205389 - 2226 WP_000698737.1 P-loop NTPase fold protein -
OT483_RS26665 (OT483_26665) 205391..206479 - 1089 WP_000952217.1 transcriptional repressor PifC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aac(3)-IVa / aph(4)-Ia / aph(6)-Id / aph(3'')-Ib / aph(3')-Ia / mph(E) / msr(E) / armA / sul1 / qacE / dfrA12 / aph(3')-IIa / mph(A) / fosA3 / sul2 / tet(A) / floR / blaTEM-1B / rmtB / blaDHA-1 / qnrB4 - 1..350595 350595


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15197.66 Da        Isoelectric Point: 7.7805

>T265557 WP_001044768.1 NZ_CP113193:c201412-200996 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8815.90 Da        Isoelectric Point: 4.3775

>AT265557 WP_001261287.1 NZ_CP113193:c201639-201409 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLEYEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A606Q844

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9QFC4

References