Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-DnaT |
| Location | 182160..182682 | Replicon | plasmid pSXC4-2_tmex_350k |
| Accession | NZ_CP113193 | ||
| Organism | Klebsiella pneumoniae strain SXC4-2 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OT483_RS26535 | Protein ID | WP_267717700.1 |
| Coordinates | 182401..182682 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | G3CAG1 |
| Locus tag | OT483_RS26530 | Protein ID | WP_000121743.1 |
| Coordinates | 182160..182411 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OT483_RS26510 (OT483_26510) | 178283..178636 | - | 354 | WP_024129958.1 | DNA distortion polypeptide 3 | - |
| OT483_RS26515 (OT483_26515) | 178773..179219 | - | 447 | WP_001074384.1 | hypothetical protein | - |
| OT483_RS26520 (OT483_26520) | 179223..180065 | - | 843 | WP_000435064.1 | replication initiation protein | - |
| OT483_RS26525 (OT483_26525) | 180086..180925 | - | 840 | WP_024129959.1 | replication initiation protein | - |
| OT483_RS26530 (OT483_26530) | 182160..182411 | + | 252 | WP_000121743.1 | plasmid stabilization protein | Antitoxin |
| OT483_RS26535 (OT483_26535) | 182401..182682 | + | 282 | WP_267717700.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OT483_RS26540 (OT483_26540) | 182921..183013 | - | 93 | Protein_194 | IS6 family transposase | - |
| OT483_RS26545 (OT483_26545) | 183179..184378 | - | 1200 | WP_000948429.1 | IS91 family transposase | - |
| OT483_RS26550 (OT483_26550) | 184388..184576 | - | 189 | WP_000957857.1 | hypothetical protein | - |
| OT483_RS26555 (OT483_26555) | 184696..186126 | + | 1431 | Protein_197 | IS4-like element IS50R family transposase | - |
| OT483_RS26560 (OT483_26560) | 186155..186949 | + | 795 | WP_000572405.1 | aminoglycoside O-phosphotransferase APH(3')-IIa | - |
| OT483_RS26565 (OT483_26565) | 186970..187206 | + | 237 | Protein_199 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aac(3)-IVa / aph(4)-Ia / aph(6)-Id / aph(3'')-Ib / aph(3')-Ia / mph(E) / msr(E) / armA / sul1 / qacE / dfrA12 / aph(3')-IIa / mph(A) / fosA3 / sul2 / tet(A) / floR / blaTEM-1B / rmtB / blaDHA-1 / qnrB4 | - | 1..350595 | 350595 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10964.79 Da Isoelectric Point: 10.4466
>T265556 WP_267717700.1 NZ_CP113193:182401-182682 [Klebsiella pneumoniae]
MTYELAFDRRALKEWQKLGHTIPEQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR
MTYELAFDRRALKEWQKLGHTIPEQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|