Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 182160..182682 Replicon plasmid pSXC4-2_tmex_350k
Accession NZ_CP113193
Organism Klebsiella pneumoniae strain SXC4-2

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag OT483_RS26535 Protein ID WP_267717700.1
Coordinates 182401..182682 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag OT483_RS26530 Protein ID WP_000121743.1
Coordinates 182160..182411 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT483_RS26510 (OT483_26510) 178283..178636 - 354 WP_024129958.1 DNA distortion polypeptide 3 -
OT483_RS26515 (OT483_26515) 178773..179219 - 447 WP_001074384.1 hypothetical protein -
OT483_RS26520 (OT483_26520) 179223..180065 - 843 WP_000435064.1 replication initiation protein -
OT483_RS26525 (OT483_26525) 180086..180925 - 840 WP_024129959.1 replication initiation protein -
OT483_RS26530 (OT483_26530) 182160..182411 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
OT483_RS26535 (OT483_26535) 182401..182682 + 282 WP_267717700.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OT483_RS26540 (OT483_26540) 182921..183013 - 93 Protein_194 IS6 family transposase -
OT483_RS26545 (OT483_26545) 183179..184378 - 1200 WP_000948429.1 IS91 family transposase -
OT483_RS26550 (OT483_26550) 184388..184576 - 189 WP_000957857.1 hypothetical protein -
OT483_RS26555 (OT483_26555) 184696..186126 + 1431 Protein_197 IS4-like element IS50R family transposase -
OT483_RS26560 (OT483_26560) 186155..186949 + 795 WP_000572405.1 aminoglycoside O-phosphotransferase APH(3')-IIa -
OT483_RS26565 (OT483_26565) 186970..187206 + 237 Protein_199 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aac(3)-IVa / aph(4)-Ia / aph(6)-Id / aph(3'')-Ib / aph(3')-Ia / mph(E) / msr(E) / armA / sul1 / qacE / dfrA12 / aph(3')-IIa / mph(A) / fosA3 / sul2 / tet(A) / floR / blaTEM-1B / rmtB / blaDHA-1 / qnrB4 - 1..350595 350595


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10964.79 Da        Isoelectric Point: 10.4466

>T265556 WP_267717700.1 NZ_CP113193:182401-182682 [Klebsiella pneumoniae]
MTYELAFDRRALKEWQKLGHTIPEQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT265556 WP_000121743.1 NZ_CP113193:182160-182411 [Klebsiella pneumoniae]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References