Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4669141..4669657 | Replicon | chromosome |
Accession | NZ_CP113192 | ||
Organism | Klebsiella pneumoniae strain SXC4-2 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A085DK79 |
Locus tag | OT483_RS22905 | Protein ID | WP_009309309.1 |
Coordinates | 4669141..4669425 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | OT483_RS22910 | Protein ID | WP_002886901.1 |
Coordinates | 4669415..4669657 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OT483_RS22880 (4664537) | 4664537..4664800 | - | 264 | WP_025368518.1 | PTS sugar transporter subunit IIB | - |
OT483_RS22885 (4664930) | 4664930..4665103 | + | 174 | WP_002886906.1 | hypothetical protein | - |
OT483_RS22890 (4665106) | 4665106..4665849 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
OT483_RS22895 (4666206) | 4666206..4668344 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
OT483_RS22900 (4668673) | 4668673..4669137 | + | 465 | WP_004192393.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
OT483_RS22905 (4669141) | 4669141..4669425 | - | 285 | WP_009309309.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OT483_RS22910 (4669415) | 4669415..4669657 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OT483_RS22915 (4669735) | 4669735..4671645 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
OT483_RS22920 (4671668) | 4671668..4672822 | - | 1155 | WP_023159544.1 | lactonase family protein | - |
OT483_RS22925 (4672889) | 4672889..4673629 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11141.99 Da Isoelectric Point: 10.3787
>T265552 WP_009309309.1 NZ_CP113192:c4669425-4669141 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A085DK79 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |