Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3954199..3954818 Replicon chromosome
Accession NZ_CP113192
Organism Klebsiella pneumoniae strain SXC4-2

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OT483_RS19520 Protein ID WP_002892050.1
Coordinates 3954600..3954818 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OT483_RS19515 Protein ID WP_002892066.1
Coordinates 3954199..3954573 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT483_RS19505 (3949351) 3949351..3950544 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OT483_RS19510 (3950567) 3950567..3953713 + 3147 WP_102024722.1 multidrug efflux RND transporter permease subunit AcrB -
OT483_RS19515 (3954199) 3954199..3954573 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OT483_RS19520 (3954600) 3954600..3954818 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OT483_RS19525 (3954981) 3954981..3955547 + 567 WP_002892030.1 maltose O-acetyltransferase -
OT483_RS19530 (3955519) 3955519..3955659 - 141 WP_004147370.1 hypothetical protein -
OT483_RS19535 (3955680) 3955680..3956150 + 471 WP_002892026.1 YlaC family protein -
OT483_RS19540 (3956125) 3956125..3957576 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
OT483_RS19545 (3957677) 3957677..3958375 + 699 WP_002892021.1 GNAT family protein -
OT483_RS19550 (3958372) 3958372..3958512 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OT483_RS19555 (3958512) 3958512..3958775 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T265550 WP_002892050.1 NZ_CP113192:3954600-3954818 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT265550 WP_002892066.1 NZ_CP113192:3954199-3954573 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References