Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3954199..3954818 | Replicon | chromosome |
Accession | NZ_CP113192 | ||
Organism | Klebsiella pneumoniae strain SXC4-2 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | OT483_RS19520 | Protein ID | WP_002892050.1 |
Coordinates | 3954600..3954818 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | OT483_RS19515 | Protein ID | WP_002892066.1 |
Coordinates | 3954199..3954573 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OT483_RS19505 (3949351) | 3949351..3950544 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
OT483_RS19510 (3950567) | 3950567..3953713 | + | 3147 | WP_102024722.1 | multidrug efflux RND transporter permease subunit AcrB | - |
OT483_RS19515 (3954199) | 3954199..3954573 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
OT483_RS19520 (3954600) | 3954600..3954818 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
OT483_RS19525 (3954981) | 3954981..3955547 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
OT483_RS19530 (3955519) | 3955519..3955659 | - | 141 | WP_004147370.1 | hypothetical protein | - |
OT483_RS19535 (3955680) | 3955680..3956150 | + | 471 | WP_002892026.1 | YlaC family protein | - |
OT483_RS19540 (3956125) | 3956125..3957576 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
OT483_RS19545 (3957677) | 3957677..3958375 | + | 699 | WP_002892021.1 | GNAT family protein | - |
OT483_RS19550 (3958372) | 3958372..3958512 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
OT483_RS19555 (3958512) | 3958512..3958775 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T265550 WP_002892050.1 NZ_CP113192:3954600-3954818 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT265550 WP_002892066.1 NZ_CP113192:3954199-3954573 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |