Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 792401..793202 | Replicon | chromosome |
Accession | NZ_CP113192 | ||
Organism | Klebsiella pneumoniae strain SXC4-2 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | OT483_RS03975 | Protein ID | WP_064143481.1 |
Coordinates | 792401..792778 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | OT483_RS03980 | Protein ID | WP_064143482.1 |
Coordinates | 792825..793202 (-) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OT483_RS03950 (788451) | 788451..789740 | + | 1290 | WP_004188585.1 | TraI domain-containing protein | - |
OT483_RS03955 (789904) | 789904..790704 | + | 801 | WP_004217751.1 | site-specific integrase | - |
OT483_RS03960 (791055) | 791055..791897 | - | 843 | WP_064143480.1 | DUF4942 domain-containing protein | - |
OT483_RS03965 (791982) | 791982..792179 | - | 198 | WP_023563519.1 | DUF957 domain-containing protein | - |
OT483_RS03970 (792207) | 792207..792404 | - | 198 | Protein_780 | DUF5983 family protein | - |
OT483_RS03975 (792401) | 792401..792778 | - | 378 | WP_064143481.1 | TA system toxin CbtA family protein | Toxin |
OT483_RS03980 (792825) | 792825..793202 | - | 378 | WP_064143482.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
OT483_RS03985 (793282) | 793282..793503 | - | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
OT483_RS03990 (793566) | 793566..794042 | - | 477 | WP_064143483.1 | RadC family protein | - |
OT483_RS03995 (794058) | 794058..794543 | - | 486 | WP_000214414.1 | antirestriction protein | - |
OT483_RS04000 (794635) | 794635..795423 | - | 789 | WP_064143484.1 | DUF932 domain-containing protein | - |
OT483_RS04005 (795514) | 795514..795747 | - | 234 | WP_001117568.1 | DUF905 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | rfaE | 670186..799232 | 129046 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14037.93 Da Isoelectric Point: 7.2922
>T265543 WP_064143481.1 NZ_CP113192:c792778-792401 [Klebsiella pneumoniae]
MKTLPDTHEREASRCSSPVTIWQTLLARLLGQHYSLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
GTCAHSQLINSIDILRARRATGLLTRSNYRTVNDIIRGKDAEAKQ
MKTLPDTHEREASRCSSPVTIWQTLLARLLGQHYSLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
GTCAHSQLINSIDILRARRATGLLTRSNYRTVNDIIRGKDAEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13751.48 Da Isoelectric Point: 5.4906
>AT265543 WP_064143482.1 NZ_CP113192:c793202-792825 [Klebsiella pneumoniae]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGQFSNADAYHLDQAFPLLLKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSWGYVYMAVYPTPAAPATTA
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGQFSNADAYHLDQAFPLLLKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSWGYVYMAVYPTPAAPATTA
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|