Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 4475146..4475825 | Replicon | chromosome |
Accession | NZ_CP113191 | ||
Organism | Klebsiella pneumoniae strain SYCC2 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | A0A0C7K7A4 |
Locus tag | OT482_RS24760 | Protein ID | WP_020324801.1 |
Coordinates | 4475146..4475487 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A0C7KEL2 |
Locus tag | OT482_RS24765 | Protein ID | WP_020324792.1 |
Coordinates | 4475508..4475825 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OT482_RS24740 (4471447) | 4471447..4473288 | + | 1842 | WP_004174339.1 | RNA polymerase sigma factor RpoD | - |
OT482_RS24745 (4473388) | 4473388..4473894 | - | 507 | WP_002917636.1 | G/U mismatch-specific DNA glycosylase | - |
OT482_RS24755 (4474197) | 4474197..4475030 | - | 834 | WP_020324805.1 | DUF4942 domain-containing protein | - |
OT482_RS24760 (4475146) | 4475146..4475487 | - | 342 | WP_020324801.1 | TA system toxin CbtA family protein | Toxin |
OT482_RS24765 (4475508) | 4475508..4475825 | - | 318 | WP_020324792.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
OT482_RS24770 (4475838) | 4475838..4476065 | - | 228 | WP_020324796.1 | DUF987 domain-containing protein | - |
OT482_RS24775 (4476074) | 4476074..4476550 | - | 477 | WP_020324797.1 | RadC family protein | - |
OT482_RS24780 (4476566) | 4476566..4477024 | - | 459 | WP_020324813.1 | antirestriction protein | - |
OT482_RS24785 (4477127) | 4477127..4477366 | - | 240 | WP_020324820.1 | DUF905 domain-containing protein | - |
OT482_RS24790 (4477459) | 4477459..4480611 | - | 3153 | WP_022631414.1 | AIDA repeat-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimG / fimF / fimD / fimD / fimC / fimI / fimA | 4475146..4522612 | 47466 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12818.91 Da Isoelectric Point: 9.1484
>T265538 WP_020324801.1 NZ_CP113191:c4475487-4475146 [Klebsiella pneumoniae]
MKTLPAIISRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFCDETVIQEHIDAGITLADAVNFLVEKYGLVRIDRNGF
VWQEQSPYLRAVDILRARQATGLLRQSRNNAIR
MKTLPAIISRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFCDETVIQEHIDAGITLADAVNFLVEKYGLVRIDRNGF
VWQEQSPYLRAVDILRARQATGLLRQSRNNAIR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0C7K7A4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0C7KEL2 |