Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4328531..4329188 | Replicon | chromosome |
Accession | NZ_CP113191 | ||
Organism | Klebsiella pneumoniae strain SYCC2 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | OT482_RS24010 | Protein ID | WP_002916310.1 |
Coordinates | 4328531..4328941 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | OT482_RS24015 | Protein ID | WP_002916312.1 |
Coordinates | 4328922..4329188 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OT482_RS23990 (4324531) | 4324531..4326264 | - | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
OT482_RS23995 (4326270) | 4326270..4326983 | - | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OT482_RS24000 (4327006) | 4327006..4327902 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
OT482_RS24005 (4328003) | 4328003..4328524 | + | 522 | WP_004144730.1 | flavodoxin FldB | - |
OT482_RS24010 (4328531) | 4328531..4328941 | - | 411 | WP_002916310.1 | protein YgfX | Toxin |
OT482_RS24015 (4328922) | 4328922..4329188 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
OT482_RS24020 (4329434) | 4329434..4330417 | + | 984 | WP_020324927.1 | tRNA-modifying protein YgfZ | - |
OT482_RS24025 (4330568) | 4330568..4331227 | - | 660 | WP_002916317.1 | hemolysin III family protein | - |
OT482_RS24030 (4331391) | 4331391..4331702 | - | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
OT482_RS24035 (4331752) | 4331752..4332480 | + | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
OT482_RS24040 (4332599) | 4332599..4334032 | + | 1434 | WP_004185559.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T265537 WP_002916310.1 NZ_CP113191:c4328941-4328531 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |