Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1143095..1143714 Replicon chromosome
Accession NZ_CP113191
Organism Klebsiella pneumoniae strain SYCC2

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OT482_RS08340 Protein ID WP_002892050.1
Coordinates 1143095..1143313 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OT482_RS08345 Protein ID WP_002892066.1
Coordinates 1143340..1143714 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT482_RS08305 (1139142) 1139142..1139405 + 264 WP_002892011.1 type B 50S ribosomal protein L31 -
OT482_RS08310 (1139405) 1139405..1139545 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OT482_RS08315 (1139542) 1139542..1140240 - 699 WP_002892021.1 GNAT family protein -
OT482_RS08320 (1140341) 1140341..1141792 + 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
OT482_RS08325 (1141767) 1141767..1142237 - 471 WP_002892026.1 YlaC family protein -
OT482_RS08330 (1142258) 1142258..1142398 + 141 WP_004147370.1 hypothetical protein -
OT482_RS08335 (1142370) 1142370..1142936 - 567 WP_002892030.1 maltose O-acetyltransferase -
OT482_RS08340 (1143095) 1143095..1143313 - 219 WP_002892050.1 HHA domain-containing protein Toxin
OT482_RS08345 (1143340) 1143340..1143714 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OT482_RS08350 (1144200) 1144200..1147346 - 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OT482_RS08355 (1147369) 1147369..1148562 - 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T265530 WP_002892050.1 NZ_CP113191:c1143313-1143095 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT265530 WP_002892066.1 NZ_CP113191:c1143714-1143340 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References