Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 507828..508638 | Replicon | chromosome |
Accession | NZ_CP113191 | ||
Organism | Klebsiella pneumoniae strain SYCC2 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A060VJ83 |
Locus tag | OT482_RS05315 | Protein ID | WP_004178461.1 |
Coordinates | 508105..508638 (+) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | OT482_RS05310 | Protein ID | WP_002887278.1 |
Coordinates | 507828..508094 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OT482_RS05290 (503700) | 503700..504044 | - | 345 | WP_004197273.1 | cation efflux system protein CusF | - |
OT482_RS05295 (504062) | 504062..505447 | - | 1386 | WP_004178457.1 | efflux transporter outer membrane subunit | - |
OT482_RS05300 (505619) | 505619..506302 | + | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
OT482_RS05305 (506292) | 506292..507725 | + | 1434 | WP_004178459.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
OT482_RS05310 (507828) | 507828..508094 | + | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
OT482_RS05315 (508105) | 508105..508638 | + | 534 | WP_004178461.1 | type II toxin-antitoxin system toxin KacT | Toxin |
OT482_RS05320 (508686) | 508686..509807 | - | 1122 | WP_002887282.1 | cupin domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19810.65 Da Isoelectric Point: 5.2614
>T265529 WP_004178461.1 NZ_CP113191:508105-508638 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060VJ83 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |