Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 396780..397296 | Replicon | chromosome |
Accession | NZ_CP113191 | ||
Organism | Klebsiella pneumoniae strain SYCC2 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | OT482_RS04865 | Protein ID | WP_004178374.1 |
Coordinates | 397012..397296 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | OT482_RS04860 | Protein ID | WP_002886901.1 |
Coordinates | 396780..397022 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OT482_RS04845 (392808) | 392808..393548 | + | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
OT482_RS04850 (393615) | 393615..394769 | + | 1155 | WP_004178372.1 | lactonase family protein | - |
OT482_RS04855 (394792) | 394792..396702 | + | 1911 | WP_004178373.1 | PRD domain-containing protein | - |
OT482_RS04860 (396780) | 396780..397022 | + | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OT482_RS04865 (397012) | 397012..397296 | + | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OT482_RS04870 (397300) | 397300..397764 | - | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
OT482_RS04875 (398005) | 398005..400143 | - | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
OT482_RS04880 (400500) | 400500..401243 | - | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
OT482_RS04885 (401246) | 401246..401419 | - | 174 | WP_032408826.1 | hypothetical protein | - |
OT482_RS04890 (401504) | 401504..401812 | + | 309 | WP_022631369.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T265528 WP_004178374.1 NZ_CP113191:397012-397296 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |