Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 5867..6392 | Replicon | plasmid pSYCC2_5 |
Accession | NZ_CP113189 | ||
Organism | Klebsiella pneumoniae strain SYCC2 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | D4HQE7 |
Locus tag | OT482_RS02575 | Protein ID | WP_013023785.1 |
Coordinates | 5867..6172 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | W8V2V6 |
Locus tag | OT482_RS02580 | Protein ID | WP_001568025.1 |
Coordinates | 6174..6392 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OT482_RS02545 (OT482_02545) | 1567..2193 | + | 627 | WP_004197649.1 | ParA family plasmid-partitioning AAA ATPase | - |
OT482_RS02550 (OT482_02550) | 2190..2492 | + | 303 | WP_004197636.1 | hypothetical protein | - |
OT482_RS02555 (OT482_02555) | 2948..3742 | - | 795 | WP_004197635.1 | site-specific integrase | - |
OT482_RS02560 (OT482_02560) | 3940..4956 | - | 1017 | WP_267689862.1 | hypothetical protein | - |
OT482_RS02565 (OT482_02565) | 4953..5276 | - | 324 | WP_004197641.1 | hypothetical protein | - |
OT482_RS02570 (OT482_02570) | 5303..5698 | - | 396 | WP_017899885.1 | hypothetical protein | - |
OT482_RS02575 (OT482_02575) | 5867..6172 | - | 306 | WP_013023785.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
OT482_RS02580 (OT482_02580) | 6174..6392 | - | 219 | WP_001568025.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
OT482_RS02585 (OT482_02590) | 7210..7500 | - | 291 | WP_013023783.1 | hypothetical protein | - |
OT482_RS02590 (OT482_02595) | 7497..8624 | - | 1128 | WP_013023782.1 | DUF4238 domain-containing protein | - |
OT482_RS02595 (OT482_02600) | 8658..10181 | - | 1524 | WP_017899887.1 | hypothetical protein | - |
OT482_RS02600 (OT482_02605) | 10457..11236 | - | 780 | WP_013023780.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | floR / tet(A) / mph(A) / sul1 / qnrB91 / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr | - | 1..57862 | 57862 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11615.30 Da Isoelectric Point: 6.4672
>T265526 WP_013023785.1 NZ_CP113189:c6172-5867 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4ZZW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4ZZP8 |