Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 28765..29290 | Replicon | plasmid pSYCC2_mcr-8_103k |
Accession | NZ_CP113187 | ||
Organism | Klebsiella pneumoniae strain SYCC2 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | D4HQE7 |
Locus tag | OT482_RS01640 | Protein ID | WP_013023785.1 |
Coordinates | 28985..29290 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | W8V2V6 |
Locus tag | OT482_RS01635 | Protein ID | WP_001568025.1 |
Coordinates | 28765..28983 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OT482_RS01615 (OT482_01615) | 24012..24980 | + | 969 | WP_075211999.1 | IS5 family transposase | - |
OT482_RS01620 (OT482_01620) | 25452..26243 | - | 792 | WP_221928726.1 | ribbon-helix-helix domain-containing protein | - |
OT482_RS01625 (OT482_01625) | 26426..27454 | - | 1029 | WP_032445668.1 | Abi family protein | - |
OT482_RS01630 (OT482_01630) | 27615..28196 | - | 582 | WP_072310991.1 | hypothetical protein | - |
OT482_RS01635 (OT482_01635) | 28765..28983 | + | 219 | WP_001568025.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
OT482_RS01640 (OT482_01640) | 28985..29290 | + | 306 | WP_013023785.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
OT482_RS01645 (OT482_01645) | 29459..29854 | + | 396 | WP_017899885.1 | hypothetical protein | - |
OT482_RS01650 (OT482_01650) | 29881..30204 | + | 324 | WP_004197641.1 | hypothetical protein | - |
OT482_RS01655 (OT482_01655) | 30201..31217 | + | 1017 | WP_118842534.1 | hypothetical protein | - |
OT482_RS01660 (OT482_01660) | 31415..32200 | + | 786 | WP_046664219.1 | site-specific integrase | - |
OT482_RS01665 (OT482_01665) | 32649..33404 | + | 756 | WP_001568031.1 | replication initiation protein RepE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | mcr-8 | - | 1..103507 | 103507 | |
- | flank | IS/Tn | mcr-8 | - | 17955..24980 | 7025 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11615.30 Da Isoelectric Point: 6.4672
>T265520 WP_013023785.1 NZ_CP113187:28985-29290 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4ZZW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4ZZP8 |