Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 200234..200756 | Replicon | plasmid pSYCC2_tmex_279k |
| Accession | NZ_CP113186 | ||
| Organism | Klebsiella pneumoniae strain SYCC2 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | A0A2J4R0S6 |
| Locus tag | OT482_RS01110 | Protein ID | WP_004181778.1 |
| Coordinates | 200472..200756 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | A0A2J4R0U8 |
| Locus tag | OT482_RS01105 | Protein ID | WP_004181777.1 |
| Coordinates | 200234..200482 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OT482_RS01085 (OT482_01085) | 195443..196264 | - | 822 | WP_004181772.1 | hypothetical protein | - |
| OT482_RS01090 (OT482_01090) | 196326..196679 | - | 354 | WP_004181774.1 | hypothetical protein | - |
| OT482_RS01095 (OT482_01095) | 196824..197810 | - | 987 | WP_025368599.1 | hypothetical protein | - |
| OT482_RS01100 (OT482_01100) | 198144..199943 | - | 1800 | WP_004181776.1 | ATP-dependent helicase | - |
| OT482_RS01105 (OT482_01105) | 200234..200482 | + | 249 | WP_004181777.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OT482_RS01110 (OT482_01110) | 200472..200756 | + | 285 | WP_004181778.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OT482_RS01115 (OT482_01115) | 200773..200874 | - | 102 | Protein_222 | IS200/IS605 family transposase | - |
| OT482_RS01120 (OT482_01120) | 200910..202136 | + | 1227 | WP_040209639.1 | RNA-guided endonuclease TnpB family protein | - |
| OT482_RS01125 (OT482_01125) | 202407..202631 | - | 225 | Protein_224 | transposase | - |
| OT482_RS01130 (OT482_01130) | 202710..203138 | - | 429 | WP_077257669.1 | IS200/IS605 family transposase | - |
| OT482_RS01135 (OT482_01135) | 203174..204361 | + | 1188 | WP_040209642.1 | RNA-guided endonuclease TnpB family protein | - |
| OT482_RS01140 (OT482_01140) | 204406..204777 | - | 372 | WP_040209644.1 | hypothetical protein | - |
| OT482_RS01145 (OT482_01145) | 204774..205118 | - | 345 | WP_223811496.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aac(3)-IVa / aph(4)-Ia / aph(6)-Id / aph(3'')-Ib / aph(3')-Ia / mph(E) / msr(E) / armA / sul1 / blaDHA-1 / qnrB4 | - | 1..279422 | 279422 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10970.69 Da Isoelectric Point: 10.6516
>T265519 WP_004181778.1 NZ_CP113186:200472-200756 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4R0S6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4R0U8 |