Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 5904..6429 Replicon plasmid pSYCC1_3
Accession NZ_CP113180
Organism Klebsiella pneumoniae strain SYCC1

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag OT490_RS27090 Protein ID WP_013023785.1
Coordinates 5904..6209 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag OT490_RS27095 Protein ID WP_001568025.1
Coordinates 6211..6429 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OT490_RS27060 (OT490_27060) 1575..2201 + 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -
OT490_RS27065 (OT490_27065) 2198..2500 + 303 WP_004197636.1 hypothetical protein -
OT490_RS27070 (OT490_27070) 2980..3774 - 795 WP_004197635.1 site-specific integrase -
OT490_RS27075 (OT490_27075) 3972..4988 - 1017 WP_017899884.1 hypothetical protein -
OT490_RS27080 (OT490_27080) 4999..5313 - 315 WP_053389906.1 hypothetical protein -
OT490_RS27085 (OT490_27085) 5340..5735 - 396 WP_017899885.1 hypothetical protein -
OT490_RS27090 (OT490_27090) 5904..6209 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
OT490_RS27095 (OT490_27095) 6211..6429 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
OT490_RS27100 (OT490_27105) 7247..7537 - 291 WP_013023783.1 hypothetical protein -
OT490_RS27105 (OT490_27110) 7534..8661 - 1128 WP_013023782.1 DUF4238 domain-containing protein -
OT490_RS27110 (OT490_27115) 8695..10218 - 1524 WP_017899887.1 hypothetical protein -
OT490_RS27115 (OT490_27120) 10494..11273 - 780 WP_013023780.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid sul2 / aph(3'')-Ib / aph(6)-Id / aph(3')-Ia / aac(3)-IId / qnrS1 / blaCTX-M-3 / aac(6')-Ib-cr / ARR-3 / dfrA27 / aadA16 / qacE / sul1 / mph(A) / tet(A) / floR / blaTEM-1B - 1..94951 94951


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T265517 WP_013023785.1 NZ_CP113180:c6209-5904 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT265517 WP_001568025.1 NZ_CP113180:c6429-6211 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References