Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 205299..205821 | Replicon | plasmid pSYCC1_tmex_287k |
| Accession | NZ_CP113179 | ||
| Organism | Klebsiella pneumoniae strain SYCC1 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | A0A2J4R0S6 |
| Locus tag | OT490_RS26650 | Protein ID | WP_004181778.1 |
| Coordinates | 205537..205821 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | A0A2J4R0U8 |
| Locus tag | OT490_RS26645 | Protein ID | WP_004181777.1 |
| Coordinates | 205299..205547 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OT490_RS26625 (OT490_26625) | 200508..201329 | - | 822 | WP_004181772.1 | hypothetical protein | - |
| OT490_RS26630 (OT490_26630) | 201391..201744 | - | 354 | WP_004181774.1 | hypothetical protein | - |
| OT490_RS26635 (OT490_26635) | 201889..202875 | - | 987 | WP_094965947.1 | hypothetical protein | - |
| OT490_RS26640 (OT490_26640) | 203209..205008 | - | 1800 | WP_267721726.1 | ATP-dependent helicase | - |
| OT490_RS26645 (OT490_26645) | 205299..205547 | + | 249 | WP_004181777.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OT490_RS26650 (OT490_26650) | 205537..205821 | + | 285 | WP_004181778.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OT490_RS26655 (OT490_26655) | 205838..205939 | - | 102 | Protein_227 | IS200/IS605 family transposase | - |
| OT490_RS26660 (OT490_26660) | 205975..207201 | + | 1227 | WP_040209639.1 | RNA-guided endonuclease TnpB family protein | - |
| OT490_RS26665 (OT490_26665) | 207472..207696 | - | 225 | Protein_229 | transposase | - |
| OT490_RS26670 (OT490_26670) | 207775..208203 | - | 429 | WP_077257669.1 | IS200/IS605 family transposase | - |
| OT490_RS26675 (OT490_26675) | 208239..209426 | + | 1188 | WP_040209642.1 | RNA-guided endonuclease TnpB family protein | - |
| OT490_RS26680 (OT490_26680) | 209471..209842 | - | 372 | WP_040209644.1 | hypothetical protein | - |
| OT490_RS26685 (OT490_26685) | 209839..210183 | - | 345 | WP_223811496.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aac(3)-IVa / aph(4)-Ia / aph(6)-Id / aph(3'')-Ib / aph(3')-Ia / mph(E) / msr(E) / armA / sul1 / blaDHA-1 / qnrB4 / mcr-1.1 | - | 1..287882 | 287882 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10970.69 Da Isoelectric Point: 10.6516
>T265516 WP_004181778.1 NZ_CP113179:205537-205821 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4R0S6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4R0U8 |